Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WKN3

Protein Details
Accession A0A4P9WKN3   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-77EPVAKRMRARPTKSAKGRRTKKNKGAVAPHydrophilic
NLS Segment(s)
PositionSequence
53-89KRMRARPTKSAKGRRTKKNKGAVAPGEKKKKVKKLAG
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSRLPSSMNIMVTTENKEGETQDLVGRPKKRKAEDMSEDVTKESEESEEPVAKRMRARPTKSAKGRRTKKNKGAVAPGEKKKKVKKLAGSTNKVKNPADSGATLLVSPTAAAPSSSLKAPATFSSSTAVVHSVLRVVIKGMPDGSIWMSKMLNSGRNKQPRLLRSVLEHMMAVLNDFDVVGVRKGPLIGDTRSVLKKKSPLPFSAAGDPNLSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.2
4 0.2
5 0.2
6 0.2
7 0.19
8 0.16
9 0.17
10 0.21
11 0.24
12 0.3
13 0.37
14 0.41
15 0.48
16 0.55
17 0.57
18 0.62
19 0.66
20 0.69
21 0.69
22 0.69
23 0.66
24 0.59
25 0.55
26 0.46
27 0.38
28 0.27
29 0.2
30 0.14
31 0.1
32 0.08
33 0.1
34 0.13
35 0.17
36 0.17
37 0.23
38 0.25
39 0.25
40 0.29
41 0.34
42 0.41
43 0.46
44 0.52
45 0.56
46 0.63
47 0.72
48 0.77
49 0.81
50 0.8
51 0.81
52 0.85
53 0.86
54 0.87
55 0.88
56 0.87
57 0.86
58 0.83
59 0.77
60 0.76
61 0.72
62 0.71
63 0.69
64 0.68
65 0.66
66 0.64
67 0.66
68 0.64
69 0.66
70 0.65
71 0.64
72 0.65
73 0.67
74 0.74
75 0.78
76 0.77
77 0.75
78 0.74
79 0.69
80 0.64
81 0.54
82 0.44
83 0.37
84 0.32
85 0.26
86 0.18
87 0.16
88 0.13
89 0.13
90 0.12
91 0.09
92 0.07
93 0.05
94 0.05
95 0.04
96 0.03
97 0.03
98 0.03
99 0.04
100 0.06
101 0.07
102 0.07
103 0.08
104 0.08
105 0.09
106 0.1
107 0.1
108 0.13
109 0.12
110 0.13
111 0.14
112 0.14
113 0.13
114 0.12
115 0.12
116 0.09
117 0.09
118 0.08
119 0.07
120 0.07
121 0.07
122 0.06
123 0.06
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.1
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.14
138 0.15
139 0.21
140 0.23
141 0.31
142 0.39
143 0.48
144 0.5
145 0.52
146 0.57
147 0.55
148 0.58
149 0.54
150 0.47
151 0.42
152 0.47
153 0.43
154 0.35
155 0.31
156 0.24
157 0.22
158 0.19
159 0.15
160 0.08
161 0.07
162 0.06
163 0.06
164 0.05
165 0.05
166 0.07
167 0.07
168 0.08
169 0.08
170 0.09
171 0.09
172 0.1
173 0.12
174 0.15
175 0.16
176 0.18
177 0.2
178 0.25
179 0.32
180 0.34
181 0.33
182 0.35
183 0.41
184 0.45
185 0.53
186 0.53
187 0.5
188 0.55
189 0.58
190 0.57
191 0.59
192 0.54
193 0.46
194 0.42