Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W398

Protein Details
Accession A0A4P9W398    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
23-42GDRVRHIRGRRRDAVRRDGABasic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008775  Phytyl_CoA_dOase-like  
Pfam View protein in Pfam  
PF05721  PhyH  
Amino Acid Sequences ASFRPLPNGPSHDLPDALPSAAGDRVRHIRGRRRDAVRRDGAACSAIASGLRAAAFVQRAVHRQASDERVPDGVSDSEYMGAESRRTPTIACWLALDDMTEFNGALVLEPYPPHTTPHPTPPFATTESHAAHHAAMSSAYPPQRLSSNSVLAEVKAGSCVFMSGHVLHCSLPNASRRFRRAWMPQFSAGAVMRGTGEKAGIPVAFAVPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.27
4 0.22
5 0.17
6 0.13
7 0.13
8 0.15
9 0.17
10 0.14
11 0.18
12 0.24
13 0.27
14 0.34
15 0.39
16 0.46
17 0.55
18 0.64
19 0.68
20 0.71
21 0.77
22 0.79
23 0.82
24 0.78
25 0.72
26 0.65
27 0.57
28 0.49
29 0.4
30 0.32
31 0.23
32 0.16
33 0.11
34 0.09
35 0.08
36 0.07
37 0.07
38 0.07
39 0.05
40 0.06
41 0.08
42 0.09
43 0.09
44 0.12
45 0.13
46 0.16
47 0.19
48 0.22
49 0.2
50 0.22
51 0.26
52 0.29
53 0.3
54 0.29
55 0.26
56 0.24
57 0.24
58 0.21
59 0.18
60 0.12
61 0.1
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.1
73 0.1
74 0.1
75 0.11
76 0.19
77 0.19
78 0.18
79 0.16
80 0.16
81 0.16
82 0.16
83 0.15
84 0.07
85 0.06
86 0.06
87 0.06
88 0.05
89 0.04
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.07
98 0.09
99 0.09
100 0.11
101 0.13
102 0.18
103 0.2
104 0.31
105 0.33
106 0.32
107 0.32
108 0.33
109 0.34
110 0.3
111 0.29
112 0.2
113 0.21
114 0.21
115 0.21
116 0.2
117 0.17
118 0.15
119 0.14
120 0.13
121 0.08
122 0.07
123 0.06
124 0.06
125 0.09
126 0.1
127 0.11
128 0.11
129 0.12
130 0.15
131 0.16
132 0.21
133 0.22
134 0.26
135 0.26
136 0.28
137 0.27
138 0.24
139 0.23
140 0.17
141 0.13
142 0.1
143 0.09
144 0.07
145 0.07
146 0.07
147 0.06
148 0.07
149 0.1
150 0.09
151 0.13
152 0.14
153 0.14
154 0.14
155 0.15
156 0.16
157 0.15
158 0.18
159 0.23
160 0.27
161 0.33
162 0.41
163 0.44
164 0.48
165 0.5
166 0.55
167 0.58
168 0.63
169 0.65
170 0.64
171 0.62
172 0.59
173 0.55
174 0.5
175 0.39
176 0.31
177 0.22
178 0.16
179 0.14
180 0.13
181 0.13
182 0.1
183 0.1
184 0.09
185 0.1
186 0.11
187 0.1
188 0.1
189 0.1