Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W6D9

Protein Details
Accession A0A4P9W6D9   
Localization Confidence High
Confidence Score 20.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-77LVSRDREKWSKNRKKRLREFRKKLAAAKBasic
114-137GEGVVGKKKKKKKKSAEVDTDPTDBasic
141-167PEEPVPVTEKKKKKREAHDGQQHRSRGBasic
NLS Segment(s)
PositionSequence
50-96LVSRDREKWSKNRKKRLREFRKKLAAAKVPHAQPEPASAKKGGKRKR
119-127GKKKKKKKK
150-180KKKKKREAHDGQQHRSRGHDAKTPGRKAPKG
Subcellular Location(s) nucl 14.5, cyto_nucl 13.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018034  Kri1  
IPR024626  Kri1-like_C  
Pfam View protein in Pfam  
PF12936  Kri1_C  
Amino Acid Sequences IGDLPTRFKYRKVEAETFGLAPTEILDADDVDLNELISLKKIAPFRRPDLVSRDREKWSKNRKKRLREFRKKLAAAKVPHAQPEPASAKKGGKRKREVEEVEGGEAAEAVAEGGEGVVGKKKKKKKKSAEVDTDPTDLSQPEEPVPVTEKKKKKREAHDGQQHRSRGHDAKTPGRKAPKGMSADRLASYTLPTKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.59
4 0.51
5 0.43
6 0.33
7 0.24
8 0.17
9 0.14
10 0.1
11 0.07
12 0.06
13 0.06
14 0.06
15 0.07
16 0.09
17 0.09
18 0.09
19 0.09
20 0.08
21 0.08
22 0.09
23 0.08
24 0.07
25 0.08
26 0.07
27 0.12
28 0.17
29 0.22
30 0.3
31 0.36
32 0.4
33 0.47
34 0.49
35 0.48
36 0.52
37 0.56
38 0.55
39 0.55
40 0.55
41 0.52
42 0.54
43 0.56
44 0.57
45 0.6
46 0.64
47 0.69
48 0.75
49 0.79
50 0.86
51 0.91
52 0.92
53 0.92
54 0.93
55 0.92
56 0.91
57 0.91
58 0.84
59 0.78
60 0.75
61 0.71
62 0.62
63 0.58
64 0.54
65 0.45
66 0.44
67 0.39
68 0.31
69 0.24
70 0.28
71 0.27
72 0.22
73 0.23
74 0.22
75 0.25
76 0.3
77 0.39
78 0.4
79 0.44
80 0.51
81 0.56
82 0.6
83 0.63
84 0.61
85 0.56
86 0.54
87 0.45
88 0.38
89 0.31
90 0.25
91 0.16
92 0.14
93 0.1
94 0.03
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.01
101 0.02
102 0.02
103 0.02
104 0.07
105 0.09
106 0.14
107 0.22
108 0.31
109 0.41
110 0.52
111 0.63
112 0.7
113 0.79
114 0.86
115 0.89
116 0.91
117 0.88
118 0.83
119 0.75
120 0.65
121 0.53
122 0.42
123 0.32
124 0.22
125 0.17
126 0.13
127 0.12
128 0.11
129 0.12
130 0.12
131 0.13
132 0.17
133 0.21
134 0.26
135 0.34
136 0.43
137 0.52
138 0.62
139 0.71
140 0.76
141 0.8
142 0.85
143 0.86
144 0.88
145 0.89
146 0.89
147 0.87
148 0.85
149 0.78
150 0.67
151 0.6
152 0.56
153 0.51
154 0.45
155 0.45
156 0.43
157 0.5
158 0.59
159 0.61
160 0.62
161 0.64
162 0.63
163 0.61
164 0.62
165 0.61
166 0.58
167 0.57
168 0.56
169 0.52
170 0.52
171 0.47
172 0.41
173 0.34
174 0.27
175 0.27
176 0.26
177 0.28