Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1IPZ8

Protein Details
Accession A0A4V1IPZ8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-118GDKRKMSVGGPKKKRKESVRBasic
NLS Segment(s)
PositionSequence
91-118TKPSGKAGGDKRKMSVGGPKKKRKESVR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR008676  MRG  
IPR025995  Tudor-knot  
Gene Ontology GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF11717  Tudor-knot  
CDD cd18983  CBD_MSL3_like  
Amino Acid Sequences MATKTEEPAFSENETVLCFHGPLMYEAKILKIEYRKSEDSPDVLTPYYRVHYRGWKKNWDEWVPESRVLKFTDENQKQQSEIEASLSPTKTKPSGKAGGDKRKMSVGGPKKKRKESVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.13
4 0.11
5 0.1
6 0.08
7 0.1
8 0.1
9 0.11
10 0.14
11 0.14
12 0.14
13 0.14
14 0.16
15 0.16
16 0.15
17 0.18
18 0.2
19 0.24
20 0.28
21 0.35
22 0.36
23 0.36
24 0.41
25 0.38
26 0.34
27 0.32
28 0.28
29 0.23
30 0.21
31 0.19
32 0.15
33 0.15
34 0.15
35 0.13
36 0.14
37 0.15
38 0.25
39 0.34
40 0.42
41 0.46
42 0.52
43 0.55
44 0.58
45 0.63
46 0.56
47 0.5
48 0.45
49 0.46
50 0.39
51 0.38
52 0.34
53 0.27
54 0.27
55 0.25
56 0.23
57 0.18
58 0.22
59 0.3
60 0.33
61 0.36
62 0.37
63 0.37
64 0.35
65 0.35
66 0.31
67 0.22
68 0.19
69 0.17
70 0.14
71 0.15
72 0.19
73 0.19
74 0.18
75 0.17
76 0.2
77 0.23
78 0.26
79 0.29
80 0.32
81 0.4
82 0.42
83 0.51
84 0.58
85 0.63
86 0.67
87 0.64
88 0.58
89 0.55
90 0.52
91 0.44
92 0.45
93 0.44
94 0.48
95 0.57
96 0.65
97 0.71
98 0.79