Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WH87

Protein Details
Accession A0A4P9WH87    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-34VRRQDCEQKARKKLRPLENEHydrophilic
NLS Segment(s)
PositionSequence
25-29RKKLR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPDSPTVRDTLKALVRRQDCEQKARKKLRPLENEEEKKSRLAKNAEEKEQLRRAFHPLPTGAAEGGQDGDPPEQEISEVCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.46
4 0.51
5 0.54
6 0.51
7 0.54
8 0.6
9 0.61
10 0.68
11 0.74
12 0.74
13 0.74
14 0.79
15 0.8
16 0.8
17 0.79
18 0.78
19 0.79
20 0.78
21 0.73
22 0.66
23 0.57
24 0.5
25 0.46
26 0.39
27 0.34
28 0.32
29 0.34
30 0.41
31 0.46
32 0.47
33 0.48
34 0.46
35 0.47
36 0.5
37 0.46
38 0.38
39 0.34
40 0.37
41 0.36
42 0.37
43 0.35
44 0.29
45 0.29
46 0.29
47 0.29
48 0.21
49 0.17
50 0.16
51 0.11
52 0.12
53 0.09
54 0.08
55 0.08
56 0.09
57 0.09
58 0.11
59 0.11
60 0.09
61 0.1