Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9VZQ3

Protein Details
Accession A0A4P9VZQ3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-41AASPVKKKKTINQKIQEKKEEEHydrophilic
NLS Segment(s)
PositionSequence
12-48KPKPAAAAAASPVKKKKTINQKIQEKKEEEERRKAAA
170-183KAATKKGKGAGKKT
Subcellular Location(s) cyto 13.5, cyto_nucl 11.833, nucl 9, mito_nucl 5.833, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences ESWEDSEDEKEKPKPAAAAAASPVKKKKTINQKIQEKKEEEERRKAAAAAKAAQPQDEEEDDYETPEEKKLRLAKKVQESDFENMKDLFAGVAIAQGPAVPAADPQTKEEFDEYVKTVMETFAKFEGRTYFSHFVETLVRDLLVTVNVDDTRRISSSIAAMVTAKQAASKAATKKGKGAGKKTLKVIGGAKDTTNYDDVYDEFEDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.37
4 0.32
5 0.31
6 0.31
7 0.37
8 0.36
9 0.39
10 0.43
11 0.38
12 0.42
13 0.43
14 0.48
15 0.51
16 0.6
17 0.66
18 0.7
19 0.78
20 0.83
21 0.88
22 0.88
23 0.8
24 0.73
25 0.73
26 0.73
27 0.69
28 0.68
29 0.62
30 0.57
31 0.55
32 0.53
33 0.48
34 0.42
35 0.39
36 0.33
37 0.34
38 0.36
39 0.35
40 0.33
41 0.28
42 0.24
43 0.24
44 0.21
45 0.18
46 0.14
47 0.16
48 0.16
49 0.16
50 0.15
51 0.13
52 0.12
53 0.14
54 0.15
55 0.12
56 0.18
57 0.25
58 0.3
59 0.36
60 0.42
61 0.46
62 0.55
63 0.62
64 0.57
65 0.54
66 0.52
67 0.49
68 0.47
69 0.4
70 0.32
71 0.24
72 0.23
73 0.18
74 0.15
75 0.1
76 0.05
77 0.05
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.04
87 0.03
88 0.03
89 0.06
90 0.09
91 0.1
92 0.12
93 0.14
94 0.14
95 0.15
96 0.16
97 0.13
98 0.12
99 0.13
100 0.12
101 0.11
102 0.1
103 0.1
104 0.09
105 0.09
106 0.1
107 0.08
108 0.09
109 0.1
110 0.12
111 0.11
112 0.12
113 0.15
114 0.16
115 0.17
116 0.23
117 0.25
118 0.24
119 0.26
120 0.25
121 0.23
122 0.23
123 0.23
124 0.16
125 0.13
126 0.12
127 0.1
128 0.1
129 0.1
130 0.07
131 0.07
132 0.06
133 0.08
134 0.08
135 0.09
136 0.09
137 0.1
138 0.12
139 0.12
140 0.13
141 0.12
142 0.12
143 0.14
144 0.15
145 0.14
146 0.12
147 0.12
148 0.11
149 0.12
150 0.11
151 0.09
152 0.08
153 0.08
154 0.09
155 0.12
156 0.17
157 0.21
158 0.3
159 0.36
160 0.37
161 0.42
162 0.49
163 0.52
164 0.54
165 0.56
166 0.57
167 0.62
168 0.66
169 0.65
170 0.63
171 0.57
172 0.53
173 0.51
174 0.47
175 0.42
176 0.39
177 0.35
178 0.32
179 0.33
180 0.31
181 0.28
182 0.22
183 0.17
184 0.17
185 0.17
186 0.19
187 0.18