Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WPB1

Protein Details
Accession A0A4P9WPB1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
105-138PPPVRNLPPRLRKLRRPPKKLRRVPRLPRVQNLPBasic
143-169KKLVLLWHKGSRRRRPCPGGHVRRYLQBasic
NLS Segment(s)
PositionSequence
25-25R
109-158RNLPPRLRKLRRPPKKLRRVPRLPRVQNLPVRPNKKLVLLWHKGSRRRRP
Subcellular Location(s) mito 11, extr 9, cyto 4, plas 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MALGSWLCLVVLCIPSCWTPFAKKRASRTPGGRGGLHRRLVSLPSPSSADARPFEVAPPAARLKHARIAAAGNHGDLAKKLEKNTTATPPTRSQKTSPNTPQTPPPPVRNLPPRLRKLRRPPKKLRRVPRLPRVQNLPVRPNKKLVLLWHKGSRRRRPCPGGHVRRYLQLREAELVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.19
5 0.19
6 0.24
7 0.32
8 0.4
9 0.48
10 0.53
11 0.6
12 0.68
13 0.71
14 0.71
15 0.7
16 0.71
17 0.69
18 0.67
19 0.61
20 0.57
21 0.61
22 0.6
23 0.57
24 0.48
25 0.41
26 0.39
27 0.39
28 0.35
29 0.31
30 0.25
31 0.22
32 0.23
33 0.22
34 0.23
35 0.22
36 0.23
37 0.18
38 0.2
39 0.19
40 0.18
41 0.17
42 0.17
43 0.17
44 0.14
45 0.17
46 0.17
47 0.16
48 0.18
49 0.2
50 0.21
51 0.26
52 0.26
53 0.23
54 0.21
55 0.23
56 0.22
57 0.24
58 0.21
59 0.14
60 0.14
61 0.14
62 0.12
63 0.11
64 0.13
65 0.12
66 0.14
67 0.15
68 0.17
69 0.19
70 0.23
71 0.26
72 0.28
73 0.28
74 0.29
75 0.32
76 0.35
77 0.38
78 0.38
79 0.37
80 0.33
81 0.37
82 0.4
83 0.46
84 0.48
85 0.52
86 0.51
87 0.51
88 0.55
89 0.5
90 0.54
91 0.48
92 0.44
93 0.42
94 0.41
95 0.46
96 0.49
97 0.52
98 0.54
99 0.6
100 0.63
101 0.68
102 0.73
103 0.75
104 0.78
105 0.81
106 0.83
107 0.84
108 0.87
109 0.88
110 0.92
111 0.92
112 0.92
113 0.91
114 0.92
115 0.92
116 0.91
117 0.91
118 0.85
119 0.81
120 0.78
121 0.76
122 0.72
123 0.69
124 0.68
125 0.66
126 0.66
127 0.62
128 0.59
129 0.53
130 0.5
131 0.47
132 0.47
133 0.48
134 0.49
135 0.52
136 0.56
137 0.61
138 0.65
139 0.71
140 0.73
141 0.73
142 0.76
143 0.81
144 0.81
145 0.82
146 0.85
147 0.86
148 0.86
149 0.84
150 0.84
151 0.76
152 0.75
153 0.72
154 0.65
155 0.6
156 0.54
157 0.49