Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9W8M9

Protein Details
Accession A0A4P9W8M9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-40VAEHHRKQRKEAKKNPGAHRKLKKBasic
NLS Segment(s)
PositionSequence
12-43KVEKRVAEHHRKQRKEAKKNPGAHRKLKKDPG
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences QSKRISAAQRYKVEKRVAEHHRKQRKEAKKNPGAHRKLKKDPGIPNLYPHKEKLLLQAEATKKKVGPSTRVKGEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.59
4 0.61
5 0.65
6 0.68
7 0.71
8 0.75
9 0.74
10 0.78
11 0.78
12 0.79
13 0.79
14 0.79
15 0.79
16 0.78
17 0.84
18 0.86
19 0.86
20 0.82
21 0.8
22 0.8
23 0.77
24 0.76
25 0.74
26 0.7
27 0.67
28 0.66
29 0.65
30 0.64
31 0.57
32 0.55
33 0.55
34 0.53
35 0.48
36 0.42
37 0.38
38 0.32
39 0.33
40 0.35
41 0.34
42 0.31
43 0.3
44 0.36
45 0.39
46 0.42
47 0.44
48 0.37
49 0.32
50 0.35
51 0.41
52 0.39
53 0.42
54 0.46
55 0.54
56 0.59