Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WBS4

Protein Details
Accession A0A4P9WBS4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
18-41IGGKGTPRRKVKKVHKSNGTDDKKBasic
NLS Segment(s)
PositionSequence
19-33GGKGTPRRKVKKVHK
Subcellular Location(s) mito 17.5, cyto_mito 11.833, cyto_nucl 5.333, cyto 5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MNPEKLAKLQASAAAVRIGGKGTPRRKVKKVHKSNGTDDKKLQSTLKKLNVQPINGVEEVNMFKADGTVLHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.13
5 0.1
6 0.09
7 0.14
8 0.21
9 0.26
10 0.35
11 0.44
12 0.51
13 0.56
14 0.66
15 0.72
16 0.74
17 0.8
18 0.8
19 0.8
20 0.79
21 0.81
22 0.81
23 0.75
24 0.66
25 0.56
26 0.51
27 0.43
28 0.4
29 0.35
30 0.3
31 0.32
32 0.38
33 0.44
34 0.47
35 0.47
36 0.54
37 0.55
38 0.51
39 0.47
40 0.42
41 0.38
42 0.31
43 0.3
44 0.2
45 0.18
46 0.19
47 0.16
48 0.14
49 0.1
50 0.09
51 0.1
52 0.1