Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VX05

Protein Details
Accession A0A4P9VX05   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
8-31GNIVRNKERFVKRRQRLIGPNGNTHydrophilic
103-128LPHFKKQNVKLPKKPKGPKKERAVFPBasic
NLS Segment(s)
PositionSequence
107-125KKQNVKLPKKPKGPKKERA
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR004087  KH_dom  
IPR036612  KH_dom_type_1_sf  
IPR024166  rRNA_assembly_KRR1  
Gene Ontology GO:0003723  F:RNA binding  
CDD cd22394  KH-I_KRR1_rpt2  
Amino Acid Sequences ACDIIKIGNIVRNKERFVKRRQRLIGPNGNTLKAIELLTKCYVMVQGNTVSAMGPFKGLKELRRIVLDCMKNIHPIYHIKELMIKRELAKDEKLKNESWDRFLPHFKKQNVKLPKKPKGPKKERAVFPAAPTPRKIDLQIESGEYFLSNREKEAIALQKKKEAQAENTAKRQQERNEAFIAPKEPAAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.59
4 0.66
5 0.71
6 0.72
7 0.79
8 0.82
9 0.81
10 0.81
11 0.83
12 0.82
13 0.75
14 0.75
15 0.67
16 0.61
17 0.52
18 0.43
19 0.34
20 0.25
21 0.22
22 0.17
23 0.15
24 0.19
25 0.2
26 0.19
27 0.18
28 0.16
29 0.18
30 0.15
31 0.15
32 0.13
33 0.13
34 0.13
35 0.14
36 0.13
37 0.11
38 0.09
39 0.09
40 0.07
41 0.07
42 0.07
43 0.07
44 0.14
45 0.15
46 0.18
47 0.25
48 0.28
49 0.28
50 0.33
51 0.33
52 0.31
53 0.37
54 0.36
55 0.29
56 0.3
57 0.29
58 0.29
59 0.28
60 0.25
61 0.19
62 0.22
63 0.26
64 0.28
65 0.27
66 0.23
67 0.3
68 0.3
69 0.31
70 0.29
71 0.25
72 0.2
73 0.24
74 0.26
75 0.22
76 0.26
77 0.28
78 0.3
79 0.35
80 0.36
81 0.33
82 0.34
83 0.39
84 0.37
85 0.34
86 0.33
87 0.31
88 0.31
89 0.38
90 0.38
91 0.38
92 0.44
93 0.43
94 0.49
95 0.51
96 0.58
97 0.61
98 0.66
99 0.68
100 0.7
101 0.77
102 0.78
103 0.82
104 0.82
105 0.83
106 0.84
107 0.84
108 0.85
109 0.85
110 0.79
111 0.77
112 0.74
113 0.65
114 0.58
115 0.57
116 0.5
117 0.43
118 0.39
119 0.37
120 0.33
121 0.33
122 0.31
123 0.27
124 0.26
125 0.27
126 0.27
127 0.25
128 0.23
129 0.21
130 0.2
131 0.15
132 0.12
133 0.12
134 0.15
135 0.12
136 0.13
137 0.15
138 0.15
139 0.16
140 0.22
141 0.29
142 0.33
143 0.4
144 0.41
145 0.46
146 0.48
147 0.52
148 0.52
149 0.48
150 0.44
151 0.48
152 0.57
153 0.57
154 0.63
155 0.64
156 0.6
157 0.6
158 0.62
159 0.57
160 0.58
161 0.57
162 0.53
163 0.52
164 0.5
165 0.48
166 0.45
167 0.41
168 0.31
169 0.26