Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WKF3

Protein Details
Accession A0A4P9WKF3   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
139-160MNSGRPVTPPRNKKKKEMAKTMHydrophilic
NLS Segment(s)
PositionSequence
147-155PPRNKKKKE
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
IPR006186  Ser/Thr-sp_prot-phosphatase  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00149  Metallophos  
Amino Acid Sequences MHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVTRFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKQKYAYGGMNSGRPVTPPRNKKKKEMAKTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.29
4 0.32
5 0.32
6 0.32
7 0.34
8 0.35
9 0.4
10 0.39
11 0.36
12 0.34
13 0.33
14 0.3
15 0.24
16 0.18
17 0.11
18 0.1
19 0.1
20 0.09
21 0.08
22 0.09
23 0.1
24 0.11
25 0.13
26 0.13
27 0.13
28 0.14
29 0.15
30 0.16
31 0.16
32 0.17
33 0.19
34 0.18
35 0.19
36 0.18
37 0.16
38 0.14
39 0.15
40 0.13
41 0.1
42 0.11
43 0.09
44 0.1
45 0.09
46 0.1
47 0.09
48 0.1
49 0.11
50 0.11
51 0.13
52 0.17
53 0.17
54 0.17
55 0.2
56 0.2
57 0.2
58 0.22
59 0.23
60 0.18
61 0.18
62 0.17
63 0.12
64 0.11
65 0.11
66 0.08
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.08
73 0.07
74 0.1
75 0.09
76 0.08
77 0.11
78 0.11
79 0.13
80 0.15
81 0.16
82 0.14
83 0.15
84 0.15
85 0.13
86 0.14
87 0.13
88 0.12
89 0.1
90 0.1
91 0.11
92 0.1
93 0.11
94 0.09
95 0.08
96 0.07
97 0.06
98 0.05
99 0.05
100 0.04
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.15
111 0.16
112 0.21
113 0.27
114 0.37
115 0.48
116 0.5
117 0.53
118 0.52
119 0.59
120 0.57
121 0.57
122 0.54
123 0.5
124 0.52
125 0.5
126 0.47
127 0.39
128 0.37
129 0.32
130 0.26
131 0.27
132 0.31
133 0.39
134 0.47
135 0.57
136 0.67
137 0.71
138 0.79
139 0.84
140 0.86