Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WIU2

Protein Details
Accession A0A4P9WIU2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-79AESSTGPRDRNRSKRNRRKPRRGSPAPVEDPBasic
NLS Segment(s)
PositionSequence
55-73PRDRNRSKRNRRKPRRGSP
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MSAAPRIVHAWELPGAQTYTPSTGAVPASPPNPCKASPSRPQSAPSREAESSTGPRDRNRSKRNRRKPRRGSPAPVEDPAPAPRSVLDRLGPRPPQATSPSSSILDRLGPRPSPTVETGVNSTPTRRGAGNRQPALFAPASVLLPPSPSHLSEQVETLSLGREAPTVDKKLPSPPTPPRSDNTASSASPSSPEPLGNWADADDEFDYATTPVFAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.16
5 0.16
6 0.16
7 0.16
8 0.16
9 0.14
10 0.15
11 0.16
12 0.15
13 0.15
14 0.16
15 0.17
16 0.21
17 0.22
18 0.24
19 0.27
20 0.27
21 0.31
22 0.36
23 0.41
24 0.47
25 0.53
26 0.56
27 0.56
28 0.6
29 0.62
30 0.61
31 0.58
32 0.51
33 0.5
34 0.43
35 0.42
36 0.39
37 0.35
38 0.32
39 0.32
40 0.34
41 0.29
42 0.33
43 0.4
44 0.47
45 0.53
46 0.6
47 0.66
48 0.73
49 0.82
50 0.9
51 0.93
52 0.95
53 0.96
54 0.96
55 0.96
56 0.95
57 0.93
58 0.9
59 0.87
60 0.85
61 0.77
62 0.67
63 0.57
64 0.47
65 0.4
66 0.34
67 0.28
68 0.18
69 0.15
70 0.15
71 0.17
72 0.17
73 0.17
74 0.17
75 0.18
76 0.21
77 0.28
78 0.28
79 0.26
80 0.27
81 0.25
82 0.26
83 0.26
84 0.26
85 0.22
86 0.23
87 0.24
88 0.23
89 0.22
90 0.19
91 0.16
92 0.16
93 0.15
94 0.14
95 0.15
96 0.14
97 0.16
98 0.17
99 0.17
100 0.17
101 0.17
102 0.18
103 0.16
104 0.17
105 0.18
106 0.17
107 0.19
108 0.16
109 0.16
110 0.15
111 0.15
112 0.16
113 0.15
114 0.17
115 0.23
116 0.32
117 0.41
118 0.42
119 0.41
120 0.41
121 0.4
122 0.41
123 0.32
124 0.22
125 0.14
126 0.12
127 0.11
128 0.11
129 0.11
130 0.07
131 0.08
132 0.08
133 0.11
134 0.12
135 0.13
136 0.15
137 0.18
138 0.21
139 0.2
140 0.21
141 0.18
142 0.17
143 0.16
144 0.14
145 0.11
146 0.09
147 0.08
148 0.07
149 0.08
150 0.08
151 0.12
152 0.17
153 0.19
154 0.21
155 0.24
156 0.25
157 0.32
158 0.38
159 0.38
160 0.41
161 0.48
162 0.54
163 0.59
164 0.6
165 0.55
166 0.56
167 0.56
168 0.51
169 0.46
170 0.42
171 0.35
172 0.36
173 0.34
174 0.27
175 0.25
176 0.23
177 0.2
178 0.17
179 0.17
180 0.15
181 0.18
182 0.2
183 0.19
184 0.18
185 0.16
186 0.16
187 0.15
188 0.18
189 0.13
190 0.11
191 0.11
192 0.1
193 0.11
194 0.1
195 0.1