Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WGD3

Protein Details
Accession A0A4P9WGD3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
14-36GARPSAVRPRPPRPTPSRICTCGHydrophilic
402-425ADILSPAKRRGQKRAPPAATPRLQHydrophilic
NLS Segment(s)
PositionSequence
13-25AGARPSAVRPRPP
409-417KRRGQKRAP
Subcellular Location(s) mito 14, nucl 5, cyto 4, extr 2
Family & Domain DBs
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences MPKSASTPSRARAGARPSAVRPRPPRPTPSRICTCGAPKTGAPPQTPPATPAPQALLIDATFRAPASSGARSINLAAALAVRMWFPPDAHRSATPPPSPTMAELSPVSTPDASTSPSPSPSTSTPLHPPNAHHPPAPNLPSQSVLTLRTFLTQALHKTGLSTHCLFFSLLLMLRLATAVRDSNIRPEPTAEIRLVGVALLLADATLNDCPVPTRVWAGLLGLEKGEVVRMKMEFLRGIGFDLSVGKSYGMFLARVVVPLLEAGVGGNGEGLGVLDIPGSVRLNVRHIYESGKARGSRGNSAPSKIQSKKAATLRNRQIARLATATSGFCHLSLDVGLGVVAAPLPLPAKGLIGSICISPPLLPDNQEAVRASRNSNPMVSDDAFTIPPILSPRALRPLDLSADILSPAKRRGQKRAPPAATPRLQRRCPSIPAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.52
4 0.5
5 0.59
6 0.62
7 0.64
8 0.65
9 0.67
10 0.72
11 0.74
12 0.78
13 0.76
14 0.81
15 0.8
16 0.81
17 0.81
18 0.75
19 0.71
20 0.67
21 0.65
22 0.62
23 0.56
24 0.5
25 0.42
26 0.45
27 0.49
28 0.48
29 0.44
30 0.41
31 0.43
32 0.45
33 0.45
34 0.41
35 0.41
36 0.39
37 0.38
38 0.36
39 0.34
40 0.3
41 0.3
42 0.27
43 0.22
44 0.17
45 0.17
46 0.15
47 0.13
48 0.1
49 0.1
50 0.09
51 0.08
52 0.11
53 0.14
54 0.16
55 0.18
56 0.19
57 0.2
58 0.21
59 0.21
60 0.19
61 0.15
62 0.12
63 0.1
64 0.09
65 0.08
66 0.08
67 0.07
68 0.06
69 0.06
70 0.08
71 0.09
72 0.09
73 0.15
74 0.2
75 0.23
76 0.26
77 0.28
78 0.3
79 0.36
80 0.43
81 0.39
82 0.36
83 0.35
84 0.35
85 0.34
86 0.32
87 0.3
88 0.22
89 0.22
90 0.2
91 0.2
92 0.17
93 0.17
94 0.17
95 0.12
96 0.12
97 0.11
98 0.12
99 0.12
100 0.13
101 0.16
102 0.16
103 0.19
104 0.2
105 0.19
106 0.22
107 0.22
108 0.26
109 0.24
110 0.26
111 0.3
112 0.34
113 0.37
114 0.35
115 0.37
116 0.41
117 0.48
118 0.46
119 0.41
120 0.38
121 0.39
122 0.44
123 0.44
124 0.37
125 0.3
126 0.29
127 0.3
128 0.28
129 0.25
130 0.19
131 0.19
132 0.17
133 0.16
134 0.15
135 0.14
136 0.14
137 0.13
138 0.13
139 0.14
140 0.15
141 0.18
142 0.18
143 0.17
144 0.17
145 0.2
146 0.2
147 0.21
148 0.21
149 0.18
150 0.17
151 0.18
152 0.18
153 0.15
154 0.13
155 0.1
156 0.09
157 0.09
158 0.08
159 0.07
160 0.07
161 0.07
162 0.06
163 0.04
164 0.05
165 0.05
166 0.05
167 0.08
168 0.08
169 0.15
170 0.19
171 0.2
172 0.19
173 0.2
174 0.23
175 0.24
176 0.26
177 0.19
178 0.15
179 0.15
180 0.14
181 0.13
182 0.09
183 0.06
184 0.03
185 0.03
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.05
198 0.06
199 0.06
200 0.08
201 0.08
202 0.09
203 0.09
204 0.09
205 0.1
206 0.1
207 0.09
208 0.08
209 0.07
210 0.07
211 0.06
212 0.08
213 0.05
214 0.05
215 0.06
216 0.07
217 0.08
218 0.09
219 0.1
220 0.09
221 0.09
222 0.1
223 0.09
224 0.1
225 0.09
226 0.08
227 0.07
228 0.08
229 0.07
230 0.07
231 0.07
232 0.06
233 0.06
234 0.06
235 0.08
236 0.07
237 0.07
238 0.06
239 0.09
240 0.09
241 0.09
242 0.09
243 0.07
244 0.06
245 0.06
246 0.06
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.02
255 0.02
256 0.02
257 0.02
258 0.02
259 0.02
260 0.02
261 0.02
262 0.03
263 0.03
264 0.04
265 0.05
266 0.05
267 0.07
268 0.08
269 0.12
270 0.14
271 0.16
272 0.17
273 0.17
274 0.2
275 0.23
276 0.27
277 0.26
278 0.3
279 0.28
280 0.28
281 0.32
282 0.31
283 0.33
284 0.32
285 0.37
286 0.35
287 0.37
288 0.39
289 0.39
290 0.45
291 0.41
292 0.44
293 0.43
294 0.44
295 0.5
296 0.53
297 0.58
298 0.56
299 0.63
300 0.66
301 0.68
302 0.65
303 0.58
304 0.56
305 0.49
306 0.46
307 0.37
308 0.29
309 0.21
310 0.22
311 0.21
312 0.17
313 0.17
314 0.14
315 0.12
316 0.11
317 0.1
318 0.09
319 0.09
320 0.09
321 0.06
322 0.06
323 0.06
324 0.05
325 0.05
326 0.04
327 0.04
328 0.03
329 0.03
330 0.03
331 0.04
332 0.04
333 0.06
334 0.06
335 0.07
336 0.08
337 0.09
338 0.08
339 0.1
340 0.11
341 0.1
342 0.1
343 0.1
344 0.1
345 0.09
346 0.1
347 0.12
348 0.12
349 0.14
350 0.17
351 0.22
352 0.22
353 0.25
354 0.25
355 0.24
356 0.28
357 0.28
358 0.28
359 0.29
360 0.34
361 0.33
362 0.34
363 0.33
364 0.28
365 0.32
366 0.31
367 0.25
368 0.22
369 0.21
370 0.2
371 0.19
372 0.18
373 0.12
374 0.13
375 0.15
376 0.16
377 0.16
378 0.19
379 0.24
380 0.32
381 0.32
382 0.31
383 0.31
384 0.33
385 0.34
386 0.33
387 0.29
388 0.21
389 0.21
390 0.21
391 0.2
392 0.18
393 0.18
394 0.2
395 0.27
396 0.34
397 0.39
398 0.49
399 0.58
400 0.65
401 0.73
402 0.81
403 0.77
404 0.78
405 0.81
406 0.8
407 0.77
408 0.76
409 0.76
410 0.75
411 0.76
412 0.73
413 0.73
414 0.7