Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WIQ3

Protein Details
Accession A0A4P9WIQ3    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
171-191DGKRFDLKKVKVKPRVKIGDTBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.333, cyto 13.5, cyto_mito 9.498, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045867  DNA-dir_RpoC_beta_prime  
IPR000722  RNA_pol_asu  
IPR006592  RNA_pol_N  
IPR007080  RNA_pol_Rpb1_1  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04997  RNA_pol_Rpb1_1  
PF00623  RNA_pol_Rpb1_2  
Amino Acid Sequences MNPENAHPEWMSITVLPVPPPCVRPNDLTHMLNNIVRFSNSIGKNEHGASVNIFPKALEVNMTNYMDNELSGVDQSLQKGGRPIKSISARLKGKEDRICKNMMGKPLDFSASSVITGDPYFSIEEAGVPKSIAFNVTFPETVNALNIENMQKLVNNSPNYPGARFNISGVDGKRFDLKKVKVKPRVKIGDTLERHMIDGDLFIFNLSGATGLMVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.17
5 0.2
6 0.22
7 0.25
8 0.26
9 0.29
10 0.31
11 0.34
12 0.38
13 0.43
14 0.46
15 0.45
16 0.43
17 0.4
18 0.39
19 0.36
20 0.31
21 0.25
22 0.19
23 0.18
24 0.18
25 0.17
26 0.23
27 0.24
28 0.26
29 0.27
30 0.27
31 0.3
32 0.29
33 0.29
34 0.22
35 0.2
36 0.19
37 0.22
38 0.23
39 0.21
40 0.2
41 0.17
42 0.16
43 0.16
44 0.14
45 0.1
46 0.09
47 0.12
48 0.17
49 0.18
50 0.17
51 0.17
52 0.18
53 0.16
54 0.14
55 0.11
56 0.07
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.07
63 0.09
64 0.1
65 0.1
66 0.15
67 0.19
68 0.21
69 0.23
70 0.24
71 0.28
72 0.33
73 0.39
74 0.38
75 0.44
76 0.43
77 0.41
78 0.47
79 0.43
80 0.46
81 0.46
82 0.47
83 0.44
84 0.44
85 0.44
86 0.39
87 0.42
88 0.38
89 0.36
90 0.34
91 0.28
92 0.27
93 0.25
94 0.25
95 0.18
96 0.16
97 0.12
98 0.09
99 0.09
100 0.08
101 0.07
102 0.07
103 0.07
104 0.07
105 0.05
106 0.05
107 0.06
108 0.05
109 0.06
110 0.05
111 0.06
112 0.07
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.07
121 0.07
122 0.08
123 0.1
124 0.1
125 0.1
126 0.11
127 0.11
128 0.1
129 0.1
130 0.1
131 0.08
132 0.08
133 0.1
134 0.1
135 0.09
136 0.1
137 0.09
138 0.1
139 0.11
140 0.16
141 0.21
142 0.22
143 0.23
144 0.25
145 0.31
146 0.31
147 0.31
148 0.28
149 0.24
150 0.26
151 0.26
152 0.24
153 0.21
154 0.21
155 0.24
156 0.23
157 0.26
158 0.22
159 0.23
160 0.3
161 0.28
162 0.31
163 0.36
164 0.42
165 0.46
166 0.56
167 0.66
168 0.68
169 0.75
170 0.79
171 0.8
172 0.82
173 0.75
174 0.73
175 0.69
176 0.69
177 0.65
178 0.61
179 0.56
180 0.47
181 0.44
182 0.37
183 0.3
184 0.2
185 0.17
186 0.14
187 0.1
188 0.09
189 0.09
190 0.08
191 0.08
192 0.07
193 0.06
194 0.05
195 0.04
196 0.04