Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W740

Protein Details
Accession A0A4P9W740    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
50-72TSAAAHKKSRRAKLRAKREEEERBasic
NLS Segment(s)
PositionSequence
55-67HKKSRRAKLRAKR
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003107  HAT  
IPR045209  Rrp5  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0006364  P:rRNA processing  
Amino Acid Sequences MLAASDDSDAEELEDVGGFNWDADGSAAPRAGADEASDDEDAADSDDEDTSAAAHKKSRRAKLRAKREEEERIAQKEISLLDGEAAPELAEDFERLLIGSPNSSFLWIKFMAFQLQMAEIEKARAVAERALKTISFREEQEKMNVWVALMNLENTYGTQQTLAKVFERAIVMNDSKAVHLQLVRIYERAEKWDLAAQLYQIMTKKFKESSKVWTGYGLYLLKRGQVEESRRVLQRSLQSLAKRKHVKTICKFAQMEFKYGEAERGRTIFEGIMSNYPKRVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.1
14 0.1
15 0.09
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.1
23 0.13
24 0.13
25 0.12
26 0.11
27 0.11
28 0.11
29 0.1
30 0.08
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.05
38 0.1
39 0.11
40 0.12
41 0.18
42 0.23
43 0.32
44 0.41
45 0.51
46 0.56
47 0.64
48 0.74
49 0.79
50 0.85
51 0.87
52 0.86
53 0.81
54 0.78
55 0.78
56 0.73
57 0.7
58 0.65
59 0.57
60 0.51
61 0.46
62 0.39
63 0.31
64 0.26
65 0.19
66 0.14
67 0.1
68 0.09
69 0.09
70 0.09
71 0.07
72 0.07
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.06
86 0.07
87 0.07
88 0.1
89 0.1
90 0.11
91 0.11
92 0.1
93 0.14
94 0.13
95 0.13
96 0.12
97 0.13
98 0.13
99 0.13
100 0.13
101 0.09
102 0.1
103 0.1
104 0.1
105 0.1
106 0.07
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.1
114 0.15
115 0.15
116 0.16
117 0.17
118 0.16
119 0.17
120 0.18
121 0.17
122 0.14
123 0.14
124 0.17
125 0.2
126 0.21
127 0.23
128 0.23
129 0.21
130 0.21
131 0.2
132 0.15
133 0.14
134 0.12
135 0.1
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.05
144 0.05
145 0.06
146 0.07
147 0.08
148 0.1
149 0.11
150 0.1
151 0.11
152 0.11
153 0.13
154 0.13
155 0.12
156 0.12
157 0.14
158 0.13
159 0.13
160 0.14
161 0.12
162 0.11
163 0.12
164 0.1
165 0.09
166 0.09
167 0.1
168 0.11
169 0.14
170 0.14
171 0.14
172 0.15
173 0.18
174 0.18
175 0.21
176 0.21
177 0.18
178 0.18
179 0.22
180 0.21
181 0.19
182 0.19
183 0.15
184 0.14
185 0.14
186 0.15
187 0.13
188 0.15
189 0.16
190 0.17
191 0.2
192 0.23
193 0.26
194 0.31
195 0.32
196 0.38
197 0.45
198 0.46
199 0.43
200 0.41
201 0.39
202 0.33
203 0.35
204 0.28
205 0.19
206 0.2
207 0.2
208 0.2
209 0.2
210 0.2
211 0.2
212 0.25
213 0.31
214 0.35
215 0.4
216 0.42
217 0.45
218 0.45
219 0.42
220 0.4
221 0.42
222 0.39
223 0.38
224 0.39
225 0.43
226 0.51
227 0.54
228 0.58
229 0.6
230 0.56
231 0.62
232 0.64
233 0.68
234 0.68
235 0.75
236 0.71
237 0.71
238 0.71
239 0.64
240 0.66
241 0.57
242 0.52
243 0.43
244 0.37
245 0.31
246 0.3
247 0.35
248 0.27
249 0.27
250 0.26
251 0.26
252 0.27
253 0.24
254 0.25
255 0.19
256 0.18
257 0.19
258 0.18
259 0.24
260 0.27
261 0.28
262 0.29