Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9W6I8

Protein Details
Accession A0A4P9W6I8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
402-422EKFVSRKARKFHLQDRRLFFPHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 12, mito 8, cyto 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019412  Iml2/TPR_39  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF10300  Iml2-TPR_39  
Amino Acid Sequences MSDIAEVEVAVSLFLDSRFSEAERLLKARSYRSLYHTLGYGVIGTIKALLTFEPQDVDAAMDALKAATDMASACRKEQGFVAGLASMVTGAGRGGRDGSNLKNMTSLQRHAELAYAEAYLLKAVLSLVTDTNMVAFVREGLNIRSAYAIYKGCYKFLEKTFEDEGSEGLERGGIDEHFVSGVLLGQGGFNLVLSMMPPRVLRLFEMIGFSGDREFALTRLEMGGGWPPTYRAAAAGGKGLRKFMCDLMLLMYHVILSSMVQLPDCNIPFAKRILEESLKNHPESFLFRTLRGRLFQTECHADLAVTEYRRVISLQKEWRQLVHICVWDMATCEAAQGHWAEATACYTTLFEESRWSKAIYRYVQAVMLYASDPEKNRDKVGEMLKEVPKLTQKIAGKSIPLEKFVSRKARKFHLQDRRLFFPWLEILYIFNGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.1
5 0.12
6 0.13
7 0.15
8 0.16
9 0.21
10 0.24
11 0.26
12 0.26
13 0.29
14 0.32
15 0.35
16 0.41
17 0.42
18 0.43
19 0.47
20 0.54
21 0.5
22 0.48
23 0.44
24 0.37
25 0.32
26 0.27
27 0.2
28 0.12
29 0.11
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.1
38 0.12
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.09
46 0.08
47 0.08
48 0.06
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.03
55 0.04
56 0.05
57 0.09
58 0.15
59 0.16
60 0.17
61 0.23
62 0.23
63 0.24
64 0.25
65 0.25
66 0.2
67 0.2
68 0.2
69 0.15
70 0.15
71 0.14
72 0.12
73 0.07
74 0.05
75 0.04
76 0.03
77 0.03
78 0.05
79 0.05
80 0.05
81 0.08
82 0.08
83 0.11
84 0.15
85 0.17
86 0.24
87 0.25
88 0.25
89 0.25
90 0.26
91 0.3
92 0.31
93 0.32
94 0.26
95 0.28
96 0.29
97 0.26
98 0.27
99 0.21
100 0.17
101 0.15
102 0.12
103 0.09
104 0.09
105 0.08
106 0.06
107 0.06
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.06
115 0.06
116 0.07
117 0.06
118 0.06
119 0.07
120 0.06
121 0.06
122 0.05
123 0.06
124 0.06
125 0.08
126 0.09
127 0.09
128 0.12
129 0.12
130 0.12
131 0.12
132 0.12
133 0.11
134 0.14
135 0.14
136 0.11
137 0.2
138 0.2
139 0.2
140 0.22
141 0.24
142 0.26
143 0.29
144 0.36
145 0.29
146 0.33
147 0.34
148 0.34
149 0.31
150 0.26
151 0.21
152 0.16
153 0.15
154 0.1
155 0.08
156 0.08
157 0.07
158 0.07
159 0.08
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.04
168 0.05
169 0.04
170 0.04
171 0.03
172 0.03
173 0.03
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.02
180 0.03
181 0.04
182 0.04
183 0.05
184 0.06
185 0.07
186 0.08
187 0.09
188 0.09
189 0.11
190 0.11
191 0.11
192 0.12
193 0.11
194 0.1
195 0.1
196 0.09
197 0.07
198 0.06
199 0.05
200 0.05
201 0.05
202 0.05
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.05
209 0.05
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.09
216 0.09
217 0.09
218 0.06
219 0.09
220 0.09
221 0.1
222 0.13
223 0.13
224 0.15
225 0.16
226 0.17
227 0.14
228 0.15
229 0.16
230 0.13
231 0.14
232 0.12
233 0.12
234 0.12
235 0.12
236 0.11
237 0.09
238 0.08
239 0.06
240 0.05
241 0.05
242 0.04
243 0.03
244 0.05
245 0.07
246 0.07
247 0.07
248 0.07
249 0.09
250 0.13
251 0.13
252 0.12
253 0.11
254 0.12
255 0.14
256 0.15
257 0.16
258 0.12
259 0.14
260 0.18
261 0.22
262 0.23
263 0.25
264 0.33
265 0.34
266 0.34
267 0.32
268 0.28
269 0.25
270 0.27
271 0.28
272 0.27
273 0.26
274 0.27
275 0.31
276 0.34
277 0.36
278 0.34
279 0.32
280 0.29
281 0.3
282 0.31
283 0.32
284 0.32
285 0.3
286 0.29
287 0.26
288 0.21
289 0.18
290 0.2
291 0.18
292 0.15
293 0.14
294 0.13
295 0.13
296 0.14
297 0.15
298 0.15
299 0.16
300 0.24
301 0.33
302 0.4
303 0.46
304 0.46
305 0.46
306 0.47
307 0.44
308 0.39
309 0.35
310 0.31
311 0.25
312 0.25
313 0.24
314 0.2
315 0.2
316 0.16
317 0.11
318 0.09
319 0.08
320 0.08
321 0.07
322 0.08
323 0.08
324 0.08
325 0.07
326 0.07
327 0.07
328 0.08
329 0.09
330 0.09
331 0.08
332 0.08
333 0.08
334 0.09
335 0.11
336 0.11
337 0.1
338 0.18
339 0.2
340 0.23
341 0.25
342 0.26
343 0.27
344 0.32
345 0.41
346 0.36
347 0.37
348 0.38
349 0.37
350 0.37
351 0.33
352 0.28
353 0.2
354 0.17
355 0.14
356 0.11
357 0.11
358 0.13
359 0.14
360 0.19
361 0.26
362 0.28
363 0.3
364 0.31
365 0.33
366 0.37
367 0.43
368 0.45
369 0.41
370 0.46
371 0.47
372 0.48
373 0.46
374 0.42
375 0.41
376 0.37
377 0.36
378 0.36
379 0.37
380 0.4
381 0.46
382 0.45
383 0.4
384 0.42
385 0.49
386 0.44
387 0.42
388 0.39
389 0.36
390 0.39
391 0.45
392 0.51
393 0.51
394 0.55
395 0.59
396 0.65
397 0.72
398 0.75
399 0.78
400 0.78
401 0.79
402 0.81
403 0.81
404 0.79
405 0.72
406 0.65
407 0.55
408 0.49
409 0.45
410 0.37
411 0.31
412 0.24
413 0.23
414 0.22