Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9W1K9

Protein Details
Accession A0A4P9W1K9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
199-221LDELDRKRKERERKKAEDAERLWBasic
NLS Segment(s)
PositionSequence
204-214RKRKERERKKA
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Amino Acid Sequences MVSIDEITPEDVAAHAAAYRAAAGPVPKDPDALLEDFMKTPLFMTSLPTGEDAEGNETLQALQSLVYEGNPDEIATNFKNQGNDCFQTGKSQYRNAIEYYSKGLAARSEDRKLNSILHSNRAAVNLELANYGKVLTDCAAALRLDVKNIKAFYRSAKALYALDRLKEALNCCDMGLEAAPTNAALKGERERIMKRQAELDELDRKRKERERKKAEDAERLWTAIRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.08
10 0.09
11 0.11
12 0.15
13 0.2
14 0.19
15 0.19
16 0.19
17 0.21
18 0.23
19 0.22
20 0.2
21 0.16
22 0.18
23 0.17
24 0.18
25 0.15
26 0.11
27 0.1
28 0.09
29 0.1
30 0.08
31 0.12
32 0.14
33 0.15
34 0.16
35 0.16
36 0.16
37 0.14
38 0.15
39 0.12
40 0.12
41 0.11
42 0.11
43 0.1
44 0.09
45 0.09
46 0.08
47 0.08
48 0.05
49 0.04
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.11
62 0.11
63 0.13
64 0.15
65 0.17
66 0.19
67 0.19
68 0.24
69 0.25
70 0.26
71 0.25
72 0.24
73 0.23
74 0.25
75 0.27
76 0.29
77 0.26
78 0.28
79 0.3
80 0.31
81 0.32
82 0.28
83 0.29
84 0.23
85 0.21
86 0.21
87 0.18
88 0.16
89 0.14
90 0.14
91 0.12
92 0.14
93 0.19
94 0.19
95 0.21
96 0.23
97 0.24
98 0.26
99 0.26
100 0.25
101 0.21
102 0.25
103 0.24
104 0.25
105 0.25
106 0.24
107 0.24
108 0.22
109 0.21
110 0.14
111 0.14
112 0.1
113 0.09
114 0.09
115 0.08
116 0.07
117 0.07
118 0.07
119 0.05
120 0.05
121 0.06
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.06
128 0.07
129 0.09
130 0.09
131 0.11
132 0.12
133 0.13
134 0.16
135 0.18
136 0.18
137 0.17
138 0.18
139 0.2
140 0.24
141 0.24
142 0.22
143 0.22
144 0.23
145 0.23
146 0.24
147 0.26
148 0.22
149 0.21
150 0.2
151 0.2
152 0.2
153 0.21
154 0.21
155 0.18
156 0.18
157 0.18
158 0.17
159 0.16
160 0.14
161 0.13
162 0.11
163 0.09
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.1
173 0.15
174 0.2
175 0.24
176 0.28
177 0.32
178 0.38
179 0.47
180 0.48
181 0.45
182 0.47
183 0.44
184 0.44
185 0.43
186 0.41
187 0.42
188 0.41
189 0.48
190 0.45
191 0.46
192 0.5
193 0.57
194 0.63
195 0.64
196 0.72
197 0.74
198 0.8
199 0.88
200 0.89
201 0.87
202 0.87
203 0.78
204 0.74
205 0.65
206 0.57
207 0.48