Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8N3W0

Protein Details
Accession B8N3W0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKKEKKKKEKQKLPNLLRTDFBasic
NLS Segment(s)
PositionSequence
2-12KKEKKKKEKQK
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKKEKKKKEKQKLPNLLRTDFSDTADWLVAGCEWGTYSRFQEPRMDPNQHQWGLSRLLSRGVLGGEGWVLVDGLTYSYPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.86
3 0.77
4 0.68
5 0.61
6 0.57
7 0.47
8 0.4
9 0.31
10 0.26
11 0.25
12 0.22
13 0.18
14 0.1
15 0.09
16 0.07
17 0.06
18 0.05
19 0.04
20 0.04
21 0.05
22 0.06
23 0.07
24 0.09
25 0.14
26 0.16
27 0.17
28 0.24
29 0.25
30 0.31
31 0.36
32 0.4
33 0.35
34 0.42
35 0.49
36 0.42
37 0.4
38 0.34
39 0.31
40 0.3
41 0.3
42 0.24
43 0.17
44 0.18
45 0.18
46 0.17
47 0.15
48 0.12
49 0.1
50 0.09
51 0.08
52 0.06
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05