Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W6K4

Protein Details
Accession A0A4P9W6K4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23LVRPKPISPKAKKYLEKTQKIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014381  Arch_Rpo5/euc_Rpb5  
IPR036710  RNA_pol_Rpb5_N_sf  
IPR000783  RNA_pol_subH/Rpb5_C  
IPR035913  RPB5-like_sf  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF01191  RNA_pol_Rpb5_C  
Amino Acid Sequences ILVRPKPISPKAKKYLEKTQKIKIESFVTDDLLVNITKHCLMPNYHVLRDTEKDDIYTTSRLQDSQLPRISLNDPVCRCYGVQRGDFISFTRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.81
4 0.82
5 0.77
6 0.76
7 0.73
8 0.69
9 0.64
10 0.57
11 0.5
12 0.41
13 0.4
14 0.32
15 0.26
16 0.23
17 0.21
18 0.17
19 0.14
20 0.13
21 0.09
22 0.08
23 0.08
24 0.07
25 0.08
26 0.08
27 0.09
28 0.1
29 0.14
30 0.23
31 0.26
32 0.26
33 0.27
34 0.28
35 0.28
36 0.28
37 0.26
38 0.2
39 0.16
40 0.16
41 0.15
42 0.16
43 0.16
44 0.16
45 0.14
46 0.15
47 0.15
48 0.15
49 0.16
50 0.21
51 0.23
52 0.29
53 0.33
54 0.31
55 0.31
56 0.34
57 0.34
58 0.34
59 0.34
60 0.34
61 0.31
62 0.33
63 0.33
64 0.32
65 0.31
66 0.3
67 0.33
68 0.31
69 0.33
70 0.33
71 0.36
72 0.37
73 0.38
74 0.33