Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N9S9

Protein Details
Accession B8N9S9   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
138-168QDAGALDKEERKRKKKERRLAEKRAKAKAETBasic
NLS Segment(s)
PositionSequence
146-165EERKRKKKERRLAEKRAKAK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.833, cyto 10, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MATGPSPLPPTFILNSKSISQSAAHDFLAAYIDLAATDPAYQPNAGISEHGPVSRTTAAAPNLTIHNLKRVKAGLAGEVLGRDLALAKLEEGDAQQQQQVGANGDWEDAKKFQEGENGDAVQDENDAQGQMEVDDAEQDAGALDKEERKRKKKERRLAEKRAKAKAETQAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.31
5 0.27
6 0.25
7 0.21
8 0.22
9 0.25
10 0.25
11 0.22
12 0.2
13 0.19
14 0.18
15 0.18
16 0.14
17 0.09
18 0.06
19 0.06
20 0.05
21 0.06
22 0.06
23 0.04
24 0.05
25 0.06
26 0.07
27 0.08
28 0.08
29 0.07
30 0.09
31 0.1
32 0.09
33 0.1
34 0.09
35 0.11
36 0.12
37 0.12
38 0.12
39 0.1
40 0.14
41 0.13
42 0.13
43 0.11
44 0.15
45 0.17
46 0.16
47 0.16
48 0.14
49 0.14
50 0.16
51 0.17
52 0.13
53 0.2
54 0.21
55 0.21
56 0.23
57 0.23
58 0.22
59 0.23
60 0.23
61 0.16
62 0.14
63 0.14
64 0.11
65 0.1
66 0.09
67 0.06
68 0.05
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.04
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.09
95 0.08
96 0.09
97 0.09
98 0.1
99 0.11
100 0.16
101 0.18
102 0.19
103 0.21
104 0.2
105 0.19
106 0.19
107 0.18
108 0.12
109 0.11
110 0.08
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.06
131 0.13
132 0.21
133 0.31
134 0.4
135 0.49
136 0.6
137 0.7
138 0.8
139 0.85
140 0.88
141 0.9
142 0.92
143 0.94
144 0.94
145 0.95
146 0.93
147 0.91
148 0.9
149 0.83
150 0.74
151 0.71
152 0.69