Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WAT4

Protein Details
Accession A0A4P9WAT4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-29GERLKVARDPRRKAIKEKQRFERLLVBasic
NLS Segment(s)
PositionSequence
8-21KVARDPRRKAIKEK
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018163  Thr/Ala-tRNA-synth_IIc_edit  
IPR012947  tRNA_SAD  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0043039  P:tRNA aminoacylation  
Pfam View protein in Pfam  
PF07973  tRNA_SAD  
Amino Acid Sequences IRHGERLKVARDPRRKAIKEKQRFERLLVTKENLLEMFKACFEALPSLNLGPFSLQHNKYKVHNINDKIPDGTSTTVYRCGPLIDLCYGPHIPDTGRIKAWAVTKKRSRFLPLNGRPCPGRRRLIGHVRNGGGERNLPFVPLCSPHRSVDVPATAFLRALILQHVISIRLCSELHPTPTVRPTPERSPAHKLSNPSRKNASSRLKYDPTTCGIAAACRCPRRVPAAQSRTRTNSQFPTLRMTLLDVTRRCHKGVPAAPRPLPEDVLVTTASKCRRLELAPLPIGRRISRRFLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.79
4 0.81
5 0.82
6 0.83
7 0.85
8 0.85
9 0.85
10 0.82
11 0.76
12 0.75
13 0.7
14 0.66
15 0.61
16 0.54
17 0.47
18 0.45
19 0.43
20 0.33
21 0.28
22 0.23
23 0.18
24 0.17
25 0.14
26 0.15
27 0.12
28 0.12
29 0.12
30 0.15
31 0.15
32 0.15
33 0.16
34 0.15
35 0.16
36 0.16
37 0.14
38 0.1
39 0.11
40 0.15
41 0.22
42 0.25
43 0.3
44 0.34
45 0.37
46 0.4
47 0.5
48 0.51
49 0.51
50 0.56
51 0.55
52 0.6
53 0.62
54 0.59
55 0.5
56 0.43
57 0.35
58 0.29
59 0.26
60 0.2
61 0.17
62 0.17
63 0.2
64 0.2
65 0.19
66 0.17
67 0.16
68 0.15
69 0.14
70 0.16
71 0.13
72 0.14
73 0.13
74 0.16
75 0.16
76 0.14
77 0.14
78 0.12
79 0.1
80 0.17
81 0.22
82 0.21
83 0.21
84 0.22
85 0.22
86 0.25
87 0.31
88 0.32
89 0.32
90 0.38
91 0.46
92 0.52
93 0.55
94 0.55
95 0.55
96 0.53
97 0.57
98 0.59
99 0.6
100 0.63
101 0.61
102 0.6
103 0.55
104 0.53
105 0.5
106 0.45
107 0.42
108 0.35
109 0.39
110 0.45
111 0.54
112 0.56
113 0.56
114 0.54
115 0.49
116 0.48
117 0.42
118 0.35
119 0.25
120 0.21
121 0.16
122 0.14
123 0.14
124 0.13
125 0.12
126 0.12
127 0.12
128 0.14
129 0.16
130 0.17
131 0.2
132 0.2
133 0.23
134 0.23
135 0.22
136 0.22
137 0.21
138 0.17
139 0.16
140 0.16
141 0.13
142 0.12
143 0.11
144 0.08
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.07
157 0.08
158 0.08
159 0.13
160 0.15
161 0.17
162 0.19
163 0.19
164 0.2
165 0.25
166 0.26
167 0.24
168 0.26
169 0.29
170 0.33
171 0.41
172 0.44
173 0.45
174 0.51
175 0.53
176 0.56
177 0.54
178 0.54
179 0.54
180 0.6
181 0.57
182 0.53
183 0.54
184 0.5
185 0.52
186 0.56
187 0.56
188 0.53
189 0.55
190 0.58
191 0.57
192 0.55
193 0.54
194 0.47
195 0.41
196 0.37
197 0.32
198 0.25
199 0.21
200 0.22
201 0.21
202 0.24
203 0.27
204 0.27
205 0.28
206 0.29
207 0.32
208 0.37
209 0.42
210 0.44
211 0.49
212 0.56
213 0.63
214 0.66
215 0.69
216 0.67
217 0.65
218 0.59
219 0.54
220 0.5
221 0.5
222 0.5
223 0.45
224 0.46
225 0.42
226 0.4
227 0.34
228 0.3
229 0.27
230 0.26
231 0.32
232 0.27
233 0.3
234 0.38
235 0.4
236 0.39
237 0.38
238 0.37
239 0.4
240 0.45
241 0.52
242 0.52
243 0.58
244 0.59
245 0.58
246 0.59
247 0.51
248 0.45
249 0.36
250 0.29
251 0.22
252 0.22
253 0.2
254 0.18
255 0.17
256 0.2
257 0.23
258 0.26
259 0.26
260 0.27
261 0.31
262 0.32
263 0.39
264 0.43
265 0.49
266 0.49
267 0.53
268 0.52
269 0.52
270 0.53
271 0.48
272 0.48
273 0.43