Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WMY3

Protein Details
Accession A0A4P9WMY3    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-38EPEGEKQAKKQSRKETKQPKPSTFHHydrophilic
47-72SNTPRSPVRRQHPSKRGKKPKTETFTHydrophilic
NLS Segment(s)
PositionSequence
53-67PVRRQHPSKRGKKPK
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MALCQPTEKPQGVEPEGEKQAKKQSRKETKQPKPSTFHGVLSAAILSNTPRSPVRRQHPSKRGKKPKTETFTWRGNYAVVLCLAGRKQIKEFKDRKKQGSAWTKVLHTLSKEMEPLNDKTQASQGSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.41
4 0.43
5 0.39
6 0.35
7 0.43
8 0.47
9 0.52
10 0.54
11 0.59
12 0.67
13 0.75
14 0.82
15 0.83
16 0.85
17 0.89
18 0.89
19 0.85
20 0.8
21 0.75
22 0.73
23 0.64
24 0.55
25 0.46
26 0.38
27 0.3
28 0.25
29 0.21
30 0.12
31 0.09
32 0.08
33 0.06
34 0.07
35 0.07
36 0.09
37 0.11
38 0.15
39 0.22
40 0.3
41 0.38
42 0.46
43 0.54
44 0.63
45 0.7
46 0.77
47 0.81
48 0.83
49 0.87
50 0.84
51 0.86
52 0.84
53 0.84
54 0.8
55 0.75
56 0.71
57 0.65
58 0.65
59 0.56
60 0.48
61 0.38
62 0.32
63 0.27
64 0.21
65 0.16
66 0.09
67 0.08
68 0.07
69 0.08
70 0.08
71 0.12
72 0.13
73 0.13
74 0.18
75 0.24
76 0.28
77 0.37
78 0.46
79 0.52
80 0.62
81 0.68
82 0.69
83 0.72
84 0.73
85 0.73
86 0.74
87 0.7
88 0.66
89 0.62
90 0.57
91 0.52
92 0.5
93 0.43
94 0.35
95 0.33
96 0.29
97 0.27
98 0.28
99 0.24
100 0.27
101 0.28
102 0.3
103 0.3
104 0.33
105 0.31
106 0.31
107 0.36
108 0.34