Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W1N4

Protein Details
Accession A0A4P9W1N4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29AGRLNHPRGQNRKRKLFTVKRLLCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR001059  Transl_elong_P/YeiP_cen  
Gene Ontology GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF01132  EFP  
Amino Acid Sequences MQGQVAGRLNHPRGQNRKRKLFTVKRLLCADPLKVHGSVVAGHMRPSDHQTRAASRQARCYLRDLCCSSSAVQPCSAVLIAAAHVVPFDLPDPEDGLNRRPAASVTPMPVSRSREDAQAPRRVVELEHKEIQYFYVDEDSLHCMGPETFEEASFPASLLADGVFASASGGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.71
4 0.79
5 0.79
6 0.8
7 0.82
8 0.82
9 0.82
10 0.83
11 0.78
12 0.74
13 0.74
14 0.67
15 0.62
16 0.54
17 0.47
18 0.39
19 0.37
20 0.33
21 0.29
22 0.27
23 0.22
24 0.2
25 0.16
26 0.16
27 0.17
28 0.14
29 0.15
30 0.16
31 0.16
32 0.16
33 0.21
34 0.24
35 0.21
36 0.26
37 0.28
38 0.32
39 0.37
40 0.43
41 0.43
42 0.39
43 0.46
44 0.48
45 0.49
46 0.45
47 0.46
48 0.45
49 0.42
50 0.47
51 0.42
52 0.36
53 0.35
54 0.34
55 0.31
56 0.29
57 0.28
58 0.23
59 0.2
60 0.18
61 0.17
62 0.16
63 0.14
64 0.09
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.06
80 0.07
81 0.09
82 0.09
83 0.12
84 0.15
85 0.15
86 0.15
87 0.14
88 0.14
89 0.14
90 0.18
91 0.17
92 0.16
93 0.18
94 0.19
95 0.21
96 0.24
97 0.27
98 0.23
99 0.27
100 0.26
101 0.27
102 0.3
103 0.35
104 0.38
105 0.42
106 0.41
107 0.37
108 0.37
109 0.33
110 0.31
111 0.32
112 0.33
113 0.31
114 0.35
115 0.34
116 0.34
117 0.34
118 0.33
119 0.26
120 0.19
121 0.14
122 0.12
123 0.12
124 0.11
125 0.13
126 0.16
127 0.15
128 0.14
129 0.13
130 0.12
131 0.12
132 0.14
133 0.13
134 0.13
135 0.13
136 0.13
137 0.14
138 0.13
139 0.15
140 0.13
141 0.12
142 0.08
143 0.08
144 0.08
145 0.08
146 0.07
147 0.06
148 0.05
149 0.06
150 0.05
151 0.04
152 0.05