Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VX07

Protein Details
Accession A0A4P9VX07   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
37-60VAPPAKSDKKKKATPSSSKKPEVEHydrophilic
73-93DDKILKRYKRLHKLKTVKGKEBasic
NLS Segment(s)
PositionSequence
42-51KSDKKKKATP
81-87KRLHKLK
Subcellular Location(s) mito 18, cyto_mito 12.5, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MTSKKAASTAAAPAAAATNGSAAAPPAAAAVPGATAVAPPAKSDKKKKATPSSSKKPEVEPNYVSQVDFSTMDDKILKRYKRLHKLKTVKGKESRADLVGSVAKHFGAVEVNEKDVISYFIYSMRNRGKIFKLPPKPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.12
4 0.08
5 0.06
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.03
22 0.03
23 0.04
24 0.06
25 0.06
26 0.07
27 0.13
28 0.2
29 0.27
30 0.37
31 0.46
32 0.52
33 0.59
34 0.68
35 0.73
36 0.76
37 0.8
38 0.82
39 0.82
40 0.82
41 0.81
42 0.73
43 0.67
44 0.65
45 0.6
46 0.55
47 0.46
48 0.4
49 0.39
50 0.38
51 0.33
52 0.24
53 0.19
54 0.15
55 0.13
56 0.11
57 0.08
58 0.08
59 0.09
60 0.1
61 0.1
62 0.15
63 0.22
64 0.22
65 0.26
66 0.35
67 0.45
68 0.54
69 0.64
70 0.65
71 0.69
72 0.77
73 0.81
74 0.83
75 0.79
76 0.77
77 0.75
78 0.73
79 0.66
80 0.61
81 0.55
82 0.45
83 0.39
84 0.31
85 0.26
86 0.23
87 0.2
88 0.15
89 0.13
90 0.11
91 0.11
92 0.11
93 0.09
94 0.08
95 0.09
96 0.14
97 0.15
98 0.16
99 0.17
100 0.17
101 0.16
102 0.14
103 0.15
104 0.1
105 0.1
106 0.09
107 0.13
108 0.18
109 0.18
110 0.26
111 0.31
112 0.36
113 0.37
114 0.43
115 0.45
116 0.5
117 0.59
118 0.62
119 0.65