Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W3Z1

Protein Details
Accession A0A4P9W3Z1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
287-315DEMEAKQRERDREKRKKQKEKVKASGGGRBasic
NLS Segment(s)
PositionSequence
293-321QRERDREKRKKQKEKVKASGGGRSSRAET
327-343EVGPKTRKKVATARLGK
Subcellular Location(s) mito 18.5, cyto_mito 12, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
IPR047139  ANKZ1/VMS1  
IPR041540  VATC  
IPR041175  VLRF1/Vms1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13637  Ank_4  
PF18826  bVLRF1  
PF18716  VATC  
PROSITE View protein in PROSITE  
PS50297  ANK_REP_REGION  
PS50088  ANK_REPEAT  
Amino Acid Sequences MGGHFAGAVFNCKTRKAIVHKTFHRYTTRRKQGGAQSSNDGAKGAAHSAGASIRRYNEQALQNEIRELLVQWKSYLAKSDLIFVHAPGASRRIVFYDTTVLDASDERVRSFPFTTRRPTFTELERCLKELTTVRMQEMSAAEEAPAPSPKPPASKPKAPATPPPTEPTEPEVHAPHPALAKLADLCRRGKVDLLQSLLAPPTDINERLPDDLGVTLLHIAAAGGHPETVTVLLDAGADPTIRSLRRGARAYDVASTKDARDAFRRFVARAPDRWDYKAAGVPGPLTDEMEAKQRERDREKRKKQKEKVKASGGGRSSRAETPEVEPEVGPKTRKKVATARLGKSEKEAIGMTPERRAMLDREKRALAAEARMRSQQQKCAACATSLVDITSFDKAQFRYCSMACVQSTSIFPTMRTNFESPRRLFCSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.35
3 0.4
4 0.49
5 0.54
6 0.63
7 0.7
8 0.77
9 0.78
10 0.76
11 0.77
12 0.72
13 0.73
14 0.74
15 0.77
16 0.73
17 0.7
18 0.72
19 0.72
20 0.76
21 0.72
22 0.64
23 0.58
24 0.58
25 0.56
26 0.47
27 0.37
28 0.26
29 0.21
30 0.19
31 0.15
32 0.11
33 0.1
34 0.1
35 0.11
36 0.14
37 0.16
38 0.17
39 0.18
40 0.2
41 0.23
42 0.25
43 0.27
44 0.31
45 0.35
46 0.36
47 0.42
48 0.43
49 0.4
50 0.39
51 0.36
52 0.29
53 0.22
54 0.2
55 0.2
56 0.19
57 0.19
58 0.18
59 0.22
60 0.24
61 0.24
62 0.28
63 0.23
64 0.24
65 0.24
66 0.3
67 0.26
68 0.28
69 0.28
70 0.22
71 0.24
72 0.2
73 0.2
74 0.15
75 0.17
76 0.15
77 0.15
78 0.16
79 0.14
80 0.15
81 0.15
82 0.16
83 0.19
84 0.18
85 0.19
86 0.19
87 0.17
88 0.15
89 0.15
90 0.16
91 0.15
92 0.15
93 0.14
94 0.15
95 0.16
96 0.18
97 0.19
98 0.24
99 0.27
100 0.32
101 0.4
102 0.44
103 0.47
104 0.49
105 0.52
106 0.49
107 0.49
108 0.53
109 0.5
110 0.52
111 0.49
112 0.46
113 0.42
114 0.38
115 0.34
116 0.29
117 0.29
118 0.28
119 0.29
120 0.28
121 0.28
122 0.28
123 0.27
124 0.23
125 0.2
126 0.13
127 0.12
128 0.11
129 0.11
130 0.11
131 0.1
132 0.11
133 0.1
134 0.1
135 0.13
136 0.15
137 0.19
138 0.23
139 0.33
140 0.39
141 0.46
142 0.5
143 0.56
144 0.61
145 0.59
146 0.63
147 0.59
148 0.57
149 0.52
150 0.5
151 0.46
152 0.4
153 0.39
154 0.34
155 0.31
156 0.26
157 0.26
158 0.24
159 0.2
160 0.21
161 0.2
162 0.17
163 0.15
164 0.14
165 0.12
166 0.11
167 0.11
168 0.1
169 0.13
170 0.16
171 0.18
172 0.19
173 0.2
174 0.22
175 0.21
176 0.21
177 0.22
178 0.23
179 0.23
180 0.24
181 0.22
182 0.21
183 0.21
184 0.2
185 0.16
186 0.1
187 0.07
188 0.06
189 0.08
190 0.08
191 0.08
192 0.1
193 0.11
194 0.12
195 0.12
196 0.11
197 0.09
198 0.09
199 0.09
200 0.06
201 0.05
202 0.04
203 0.04
204 0.04
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.04
217 0.03
218 0.03
219 0.03
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.05
227 0.07
228 0.07
229 0.09
230 0.13
231 0.17
232 0.25
233 0.27
234 0.28
235 0.3
236 0.32
237 0.32
238 0.33
239 0.29
240 0.23
241 0.22
242 0.22
243 0.17
244 0.19
245 0.19
246 0.17
247 0.22
248 0.24
249 0.25
250 0.29
251 0.31
252 0.28
253 0.31
254 0.38
255 0.36
256 0.37
257 0.4
258 0.41
259 0.42
260 0.43
261 0.41
262 0.33
263 0.31
264 0.3
265 0.25
266 0.2
267 0.18
268 0.16
269 0.14
270 0.15
271 0.13
272 0.1
273 0.09
274 0.09
275 0.1
276 0.17
277 0.18
278 0.16
279 0.22
280 0.26
281 0.34
282 0.42
283 0.51
284 0.56
285 0.66
286 0.76
287 0.81
288 0.88
289 0.91
290 0.93
291 0.94
292 0.93
293 0.93
294 0.91
295 0.88
296 0.85
297 0.76
298 0.73
299 0.66
300 0.6
301 0.51
302 0.43
303 0.38
304 0.33
305 0.32
306 0.27
307 0.25
308 0.24
309 0.28
310 0.28
311 0.26
312 0.23
313 0.23
314 0.26
315 0.27
316 0.27
317 0.24
318 0.28
319 0.34
320 0.37
321 0.41
322 0.46
323 0.51
324 0.59
325 0.64
326 0.63
327 0.66
328 0.66
329 0.61
330 0.56
331 0.52
332 0.41
333 0.35
334 0.3
335 0.21
336 0.25
337 0.3
338 0.27
339 0.25
340 0.26
341 0.24
342 0.24
343 0.26
344 0.25
345 0.31
346 0.39
347 0.41
348 0.45
349 0.45
350 0.45
351 0.44
352 0.43
353 0.35
354 0.34
355 0.35
356 0.33
357 0.35
358 0.38
359 0.4
360 0.44
361 0.46
362 0.45
363 0.48
364 0.49
365 0.49
366 0.52
367 0.5
368 0.41
369 0.38
370 0.33
371 0.28
372 0.24
373 0.22
374 0.16
375 0.16
376 0.17
377 0.19
378 0.17
379 0.14
380 0.18
381 0.19
382 0.25
383 0.28
384 0.28
385 0.31
386 0.31
387 0.34
388 0.32
389 0.38
390 0.32
391 0.32
392 0.31
393 0.28
394 0.29
395 0.29
396 0.31
397 0.25
398 0.25
399 0.31
400 0.33
401 0.34
402 0.39
403 0.39
404 0.42
405 0.5
406 0.59
407 0.53
408 0.58