Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W3I1

Protein Details
Accession A0A4P9W3I1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTQKRRNNGRSKKGRGHTRAVRCSNCHydrophilic
83-104VVRVRSREGRRNRDPPQRIRGFBasic
NLS Segment(s)
PositionSequence
5-16RRNNGRSKKGRG
Subcellular Location(s) mito 15.5, mito_nucl 10.5, cyto 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTQKRRNNGRSKKGRGHTRAVRCSNCSRCVPKDKAIKRFLIRNMVELAAIRDISEASVFEEYALPKLYIKMLYCVSCAIHSHVVRVRSREGRRNRDPPQRIRGFNKLHTSPAVGAAEGWSRPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.84
4 0.83
5 0.82
6 0.83
7 0.81
8 0.76
9 0.71
10 0.74
11 0.7
12 0.66
13 0.62
14 0.59
15 0.58
16 0.63
17 0.62
18 0.61
19 0.65
20 0.67
21 0.69
22 0.68
23 0.68
24 0.62
25 0.64
26 0.6
27 0.59
28 0.52
29 0.44
30 0.41
31 0.34
32 0.3
33 0.23
34 0.2
35 0.11
36 0.11
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.07
48 0.07
49 0.07
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.09
56 0.1
57 0.12
58 0.13
59 0.13
60 0.14
61 0.14
62 0.13
63 0.12
64 0.13
65 0.14
66 0.18
67 0.17
68 0.21
69 0.23
70 0.28
71 0.29
72 0.31
73 0.34
74 0.36
75 0.43
76 0.48
77 0.55
78 0.6
79 0.67
80 0.74
81 0.77
82 0.79
83 0.81
84 0.81
85 0.81
86 0.8
87 0.77
88 0.74
89 0.75
90 0.71
91 0.69
92 0.69
93 0.61
94 0.56
95 0.51
96 0.48
97 0.39
98 0.38
99 0.32
100 0.23
101 0.21
102 0.19
103 0.21
104 0.17