Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W0U8

Protein Details
Accession A0A4P9W0U8    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
80-99DETPKPKSTKPRSRKSPLPSHydrophilic
NLS Segment(s)
PositionSequence
16-20KRAAP
47-76KKEASTKVRKAADQKAARSPSPKSAKRSHP
83-95PKPKSTKPRSRKS
113-121KKPKTVRKR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MPIPDPPVASEKQTKKRAAPANSRAKRAGATTSSSLEAEEETGVKVKKEASTKVRKAADQKAARSPSPKSAKRSHPDDDDETPKPKSTKPRSRKSPLPSAASIEVDWEEAAPKKPKTVRKRSPSTQVDGEEDPPKKPRTVRSKSPSTQVVAADAKAQPTQSEVRTRVSSSSQAREVDERTEEDEVLRLLRENLSPPPSEQVSSVDAMDVEIARDLAALDDWQAIMRNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.68
4 0.72
5 0.72
6 0.73
7 0.73
8 0.76
9 0.77
10 0.77
11 0.69
12 0.62
13 0.54
14 0.46
15 0.42
16 0.34
17 0.33
18 0.3
19 0.31
20 0.3
21 0.28
22 0.26
23 0.2
24 0.17
25 0.13
26 0.1
27 0.09
28 0.08
29 0.12
30 0.12
31 0.12
32 0.13
33 0.14
34 0.19
35 0.23
36 0.3
37 0.36
38 0.47
39 0.51
40 0.58
41 0.59
42 0.58
43 0.6
44 0.61
45 0.62
46 0.57
47 0.57
48 0.57
49 0.57
50 0.55
51 0.52
52 0.45
53 0.45
54 0.49
55 0.51
56 0.48
57 0.53
58 0.61
59 0.65
60 0.69
61 0.64
62 0.6
63 0.6
64 0.58
65 0.54
66 0.5
67 0.46
68 0.42
69 0.38
70 0.35
71 0.31
72 0.31
73 0.36
74 0.41
75 0.5
76 0.57
77 0.66
78 0.73
79 0.79
80 0.83
81 0.79
82 0.79
83 0.73
84 0.69
85 0.59
86 0.52
87 0.46
88 0.39
89 0.32
90 0.22
91 0.16
92 0.11
93 0.1
94 0.07
95 0.06
96 0.06
97 0.1
98 0.13
99 0.13
100 0.17
101 0.23
102 0.32
103 0.42
104 0.52
105 0.58
106 0.64
107 0.72
108 0.73
109 0.78
110 0.73
111 0.67
112 0.6
113 0.52
114 0.46
115 0.38
116 0.36
117 0.32
118 0.29
119 0.25
120 0.26
121 0.26
122 0.25
123 0.27
124 0.33
125 0.39
126 0.45
127 0.54
128 0.58
129 0.66
130 0.66
131 0.68
132 0.63
133 0.54
134 0.49
135 0.39
136 0.35
137 0.26
138 0.24
139 0.21
140 0.18
141 0.17
142 0.15
143 0.15
144 0.1
145 0.12
146 0.16
147 0.16
148 0.23
149 0.24
150 0.28
151 0.3
152 0.31
153 0.3
154 0.3
155 0.34
156 0.32
157 0.35
158 0.34
159 0.33
160 0.34
161 0.35
162 0.34
163 0.29
164 0.27
165 0.23
166 0.22
167 0.22
168 0.2
169 0.17
170 0.17
171 0.14
172 0.13
173 0.12
174 0.1
175 0.1
176 0.12
177 0.13
178 0.14
179 0.19
180 0.22
181 0.23
182 0.24
183 0.28
184 0.28
185 0.27
186 0.25
187 0.23
188 0.22
189 0.22
190 0.21
191 0.16
192 0.14
193 0.13
194 0.13
195 0.1
196 0.08
197 0.07
198 0.07
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.07
206 0.08
207 0.08
208 0.09