Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WK56

Protein Details
Accession A0A4P9WK56    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28QNHTNHNQNKKAHRNGIKKPKVNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
11-22KAHRNGIKKPKV
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences QNHTNHNQNKKAHRNGIKKPKVNRYPSLRGVDPKFLRNQRFAKKGDLGALDTESDGGEGGRFGNGGYHVGMGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.87
4 0.86
5 0.83
6 0.83
7 0.84
8 0.83
9 0.8
10 0.78
11 0.75
12 0.73
13 0.73
14 0.69
15 0.61
16 0.57
17 0.53
18 0.53
19 0.46
20 0.41
21 0.41
22 0.42
23 0.42
24 0.43
25 0.48
26 0.46
27 0.51
28 0.5
29 0.48
30 0.46
31 0.45
32 0.42
33 0.35
34 0.29
35 0.24
36 0.23
37 0.17
38 0.14
39 0.13
40 0.09
41 0.07
42 0.06
43 0.05
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.07
51 0.08
52 0.09
53 0.1