Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VWA0

Protein Details
Accession A0A4P9VWA0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
32-51INIKRVKKSRRDGTPPPAKLHydrophilic
NLS Segment(s)
PositionSequence
35-42KRVKKSRR
Subcellular Location(s) cyto 12.5, cyto_nucl 10.333, nucl 7, mito_nucl 6.833, cyto_pero 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR041432  UBP13_Znf-UBP_var  
IPR013083  Znf_RING/FYVE/PHD  
Pfam View protein in Pfam  
PF17807  zf-UBP_var  
Amino Acid Sequences DVCLTCFNGGCLGNEQLHSKLHFKKTAHPLVINIKRVKKSRRDGTPPPAKLTKLAIEEERDEDKYEFVTAVTCHACDGAEVERTSGNLPAVIDSIMAALSAKKQSEIKAWQEEISSCMHTENLEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.21
4 0.23
5 0.24
6 0.26
7 0.31
8 0.37
9 0.42
10 0.41
11 0.49
12 0.56
13 0.62
14 0.6
15 0.53
16 0.51
17 0.54
18 0.6
19 0.58
20 0.53
21 0.5
22 0.53
23 0.59
24 0.62
25 0.61
26 0.64
27 0.66
28 0.7
29 0.73
30 0.74
31 0.78
32 0.8
33 0.73
34 0.68
35 0.62
36 0.52
37 0.45
38 0.4
39 0.34
40 0.26
41 0.25
42 0.22
43 0.21
44 0.22
45 0.23
46 0.22
47 0.18
48 0.17
49 0.16
50 0.14
51 0.12
52 0.11
53 0.09
54 0.07
55 0.07
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.07
63 0.06
64 0.08
65 0.07
66 0.1
67 0.1
68 0.11
69 0.11
70 0.12
71 0.13
72 0.12
73 0.11
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.07
87 0.1
88 0.1
89 0.12
90 0.15
91 0.17
92 0.25
93 0.31
94 0.35
95 0.4
96 0.42
97 0.41
98 0.41
99 0.39
100 0.33
101 0.3
102 0.24
103 0.17
104 0.16
105 0.15
106 0.14