Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WPS2

Protein Details
Accession A0A4P9WPS2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
139-170VDSTKSLARKFRRWRSRRKRLAKDARRHGNRGBasic
NLS Segment(s)
PositionSequence
146-196ARKFRRWRSRRKRLAKDARRHGNRGSTGAATLPKKPSVGPRYPRTRTARAT
Subcellular Location(s) cyto 9.5, cyto_mito 9, mito 7.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000014  PAS  
IPR035965  PAS-like_dom_sf  
IPR013767  PAS_fold  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00989  PAS  
PROSITE View protein in PROSITE  
PS50112  PAS  
CDD cd00130  PAS  
Amino Acid Sequences FGGAIADLCGRSWPLGIYKRSNGSGKGIGSAKDTKVHTDLTRALVTRRAVSFCFGSRLLVVEGLCADIWGAEPRSRISCPQHSGLLIASWIFGFLYGIEDRYEQLPTNRNESYETEQQHEIEGREAQAKLVQMKGRSFVDSTKSLARKFRRWRSRRKRLAKDARRHGNRGSTGAATLPKKPSVGPRYPRTRTARATKNAQRRTAPSVDGDELSNAAFDRGDDAGEELGSLMQAEIRRLENRQREEISAQLRLHRAAVAATDAATMRNVTQHREETETIACSHRREAEAQARARNAEARIMLEQRVMSRLLDSVVDGVISITPNGNIVKFHTAAEEMFKYSAKEVLGKNNPFQRLFSNPLNRSHSNALVKHDSYLKRYMKSGVSKQIGNTSRQLGRRKNGEIFPMELSLSEVNLAEYHASVAILVRPNLIGGFSKLLTDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.27
3 0.34
4 0.39
5 0.45
6 0.5
7 0.54
8 0.56
9 0.5
10 0.48
11 0.47
12 0.41
13 0.41
14 0.38
15 0.34
16 0.35
17 0.38
18 0.34
19 0.34
20 0.34
21 0.33
22 0.33
23 0.37
24 0.33
25 0.33
26 0.35
27 0.34
28 0.37
29 0.34
30 0.33
31 0.34
32 0.35
33 0.34
34 0.33
35 0.31
36 0.28
37 0.3
38 0.31
39 0.28
40 0.3
41 0.25
42 0.23
43 0.2
44 0.22
45 0.2
46 0.19
47 0.16
48 0.13
49 0.13
50 0.12
51 0.12
52 0.09
53 0.08
54 0.05
55 0.07
56 0.1
57 0.12
58 0.13
59 0.15
60 0.17
61 0.21
62 0.23
63 0.28
64 0.32
65 0.39
66 0.42
67 0.43
68 0.44
69 0.4
70 0.4
71 0.34
72 0.27
73 0.18
74 0.13
75 0.1
76 0.07
77 0.07
78 0.06
79 0.05
80 0.04
81 0.04
82 0.07
83 0.07
84 0.08
85 0.09
86 0.1
87 0.11
88 0.12
89 0.13
90 0.11
91 0.16
92 0.23
93 0.24
94 0.3
95 0.29
96 0.29
97 0.31
98 0.34
99 0.36
100 0.35
101 0.35
102 0.33
103 0.33
104 0.33
105 0.31
106 0.3
107 0.24
108 0.19
109 0.18
110 0.15
111 0.18
112 0.17
113 0.16
114 0.15
115 0.17
116 0.16
117 0.2
118 0.21
119 0.21
120 0.22
121 0.25
122 0.24
123 0.24
124 0.23
125 0.22
126 0.24
127 0.22
128 0.24
129 0.28
130 0.3
131 0.31
132 0.38
133 0.41
134 0.46
135 0.55
136 0.63
137 0.67
138 0.72
139 0.81
140 0.84
141 0.9
142 0.91
143 0.91
144 0.91
145 0.92
146 0.95
147 0.93
148 0.92
149 0.91
150 0.91
151 0.85
152 0.78
153 0.7
154 0.66
155 0.58
156 0.5
157 0.42
158 0.31
159 0.26
160 0.24
161 0.25
162 0.19
163 0.21
164 0.21
165 0.2
166 0.2
167 0.21
168 0.28
169 0.31
170 0.39
171 0.43
172 0.49
173 0.58
174 0.6
175 0.67
176 0.65
177 0.65
178 0.62
179 0.64
180 0.64
181 0.59
182 0.66
183 0.65
184 0.69
185 0.68
186 0.66
187 0.59
188 0.54
189 0.55
190 0.49
191 0.42
192 0.33
193 0.29
194 0.26
195 0.24
196 0.2
197 0.14
198 0.11
199 0.1
200 0.09
201 0.06
202 0.05
203 0.04
204 0.03
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.05
211 0.05
212 0.05
213 0.04
214 0.03
215 0.03
216 0.03
217 0.02
218 0.04
219 0.05
220 0.05
221 0.07
222 0.09
223 0.1
224 0.12
225 0.2
226 0.26
227 0.29
228 0.34
229 0.34
230 0.34
231 0.34
232 0.37
233 0.32
234 0.3
235 0.26
236 0.25
237 0.24
238 0.23
239 0.22
240 0.18
241 0.15
242 0.1
243 0.1
244 0.08
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.06
252 0.05
253 0.1
254 0.11
255 0.13
256 0.17
257 0.19
258 0.21
259 0.25
260 0.26
261 0.24
262 0.25
263 0.24
264 0.21
265 0.22
266 0.21
267 0.18
268 0.2
269 0.2
270 0.2
271 0.2
272 0.26
273 0.31
274 0.37
275 0.4
276 0.41
277 0.39
278 0.38
279 0.37
280 0.34
281 0.26
282 0.22
283 0.19
284 0.17
285 0.19
286 0.2
287 0.2
288 0.17
289 0.17
290 0.15
291 0.16
292 0.15
293 0.12
294 0.11
295 0.11
296 0.1
297 0.09
298 0.09
299 0.08
300 0.07
301 0.06
302 0.06
303 0.05
304 0.05
305 0.06
306 0.06
307 0.05
308 0.05
309 0.07
310 0.08
311 0.08
312 0.08
313 0.11
314 0.15
315 0.15
316 0.16
317 0.15
318 0.16
319 0.16
320 0.19
321 0.18
322 0.15
323 0.15
324 0.15
325 0.15
326 0.15
327 0.17
328 0.14
329 0.18
330 0.18
331 0.28
332 0.36
333 0.38
334 0.43
335 0.47
336 0.51
337 0.47
338 0.46
339 0.4
340 0.38
341 0.41
342 0.44
343 0.48
344 0.47
345 0.54
346 0.59
347 0.57
348 0.55
349 0.53
350 0.52
351 0.49
352 0.48
353 0.47
354 0.46
355 0.45
356 0.42
357 0.46
358 0.42
359 0.39
360 0.46
361 0.45
362 0.4
363 0.42
364 0.45
365 0.45
366 0.5
367 0.54
368 0.54
369 0.53
370 0.53
371 0.52
372 0.57
373 0.53
374 0.48
375 0.44
376 0.4
377 0.43
378 0.48
379 0.55
380 0.54
381 0.58
382 0.62
383 0.65
384 0.66
385 0.64
386 0.63
387 0.58
388 0.52
389 0.47
390 0.4
391 0.34
392 0.26
393 0.24
394 0.18
395 0.15
396 0.13
397 0.1
398 0.09
399 0.1
400 0.1
401 0.08
402 0.08
403 0.09
404 0.08
405 0.08
406 0.07
407 0.08
408 0.13
409 0.16
410 0.16
411 0.16
412 0.16
413 0.17
414 0.17
415 0.17
416 0.14
417 0.13
418 0.16
419 0.15