Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WA44

Protein Details
Accession A0A4P9WA44   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-99VETCSKKCATPRKRNRHLIHRHKFPSHydrophilic
NLS Segment(s)
PositionSequence
119-132SGSAGGRRGGVRKR
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039258  ZNF511  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences ISCTLSPSCSLLDPFETAAAYEAHYAEMHQNVCATCRRVLPTSRLLDLHLSECHDSFFSVLADRQNMVCYECFVETCSKKCATPRKRNRHLIHRHKFPSDFDFGVILGVDPRSAKSVKSGSAGGRRGGVRKREDGAGQKGVEKMEMDEDEHSKGGRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.13
5 0.13
6 0.11
7 0.1
8 0.1
9 0.09
10 0.09
11 0.09
12 0.1
13 0.11
14 0.15
15 0.14
16 0.13
17 0.15
18 0.14
19 0.17
20 0.2
21 0.21
22 0.19
23 0.23
24 0.26
25 0.29
26 0.32
27 0.35
28 0.39
29 0.4
30 0.39
31 0.36
32 0.34
33 0.31
34 0.29
35 0.26
36 0.19
37 0.17
38 0.16
39 0.16
40 0.15
41 0.13
42 0.12
43 0.09
44 0.09
45 0.07
46 0.07
47 0.09
48 0.09
49 0.1
50 0.1
51 0.1
52 0.1
53 0.1
54 0.11
55 0.09
56 0.09
57 0.1
58 0.09
59 0.09
60 0.09
61 0.14
62 0.15
63 0.16
64 0.19
65 0.18
66 0.19
67 0.24
68 0.34
69 0.39
70 0.49
71 0.58
72 0.66
73 0.76
74 0.85
75 0.86
76 0.86
77 0.86
78 0.86
79 0.85
80 0.83
81 0.77
82 0.71
83 0.66
84 0.58
85 0.51
86 0.44
87 0.35
88 0.26
89 0.23
90 0.19
91 0.17
92 0.14
93 0.09
94 0.06
95 0.06
96 0.05
97 0.05
98 0.06
99 0.09
100 0.09
101 0.09
102 0.14
103 0.17
104 0.19
105 0.22
106 0.24
107 0.26
108 0.34
109 0.36
110 0.32
111 0.33
112 0.33
113 0.36
114 0.4
115 0.42
116 0.4
117 0.42
118 0.44
119 0.43
120 0.47
121 0.48
122 0.48
123 0.47
124 0.43
125 0.41
126 0.4
127 0.36
128 0.33
129 0.26
130 0.2
131 0.19
132 0.2
133 0.19
134 0.2
135 0.22
136 0.23
137 0.23
138 0.21