Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VW52

Protein Details
Accession A0A4P9VW52   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
142-161VPRGTEFAKKFKRRYKAAKKBasic
NLS Segment(s)
PositionSequence
150-161KKFKRRYKAAKK
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 9, extr 2, mito 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR044059  Csn1/TTC4_wheel  
Gene Ontology GO:0051879  F:Hsp90 protein binding  
Pfam View protein in Pfam  
PF18972  Wheel  
CDD cd21380  CTWD_Cns1  
Amino Acid Sequences MINSASPPKPEDLDSDNEDAQPPAPHPRVHPDHPPTLDPETNRLTWPVLLAYPEYNQTDLIAAFHEDSTFADQLDVVFEHPPEWDARGEYRDAAALDVYFEAETDDGIGKRLMRIGRELTLGEVVADLAYRIVDGVAVFLVVPRGTEFAKKFKRRYKAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.33
4 0.31
5 0.31
6 0.26
7 0.23
8 0.19
9 0.16
10 0.21
11 0.24
12 0.25
13 0.27
14 0.36
15 0.41
16 0.44
17 0.52
18 0.5
19 0.54
20 0.55
21 0.54
22 0.49
23 0.47
24 0.46
25 0.37
26 0.36
27 0.32
28 0.31
29 0.3
30 0.26
31 0.22
32 0.19
33 0.18
34 0.14
35 0.11
36 0.1
37 0.11
38 0.11
39 0.11
40 0.13
41 0.13
42 0.13
43 0.12
44 0.11
45 0.11
46 0.1
47 0.09
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.09
56 0.09
57 0.08
58 0.07
59 0.07
60 0.07
61 0.08
62 0.07
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.08
73 0.09
74 0.1
75 0.11
76 0.1
77 0.1
78 0.1
79 0.1
80 0.09
81 0.08
82 0.06
83 0.06
84 0.06
85 0.06
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.06
93 0.05
94 0.07
95 0.07
96 0.07
97 0.08
98 0.12
99 0.13
100 0.13
101 0.17
102 0.18
103 0.19
104 0.21
105 0.21
106 0.18
107 0.17
108 0.16
109 0.12
110 0.09
111 0.07
112 0.06
113 0.05
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.06
128 0.06
129 0.06
130 0.06
131 0.09
132 0.1
133 0.17
134 0.2
135 0.29
136 0.4
137 0.48
138 0.57
139 0.64
140 0.73
141 0.77