Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W686

Protein Details
Accession A0A4P9W686   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
151-179AWRRHPAIPRRPGRYRHRRRNPLLTHEGPBasic
NLS Segment(s)
PositionSequence
153-170RRHPAIPRRPGRYRHRRR
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MTQYLAGEGVSAKRRSPLSSRPGSGLYDPFRRLHLTQSEGEVQDGRYAPTRVRRRVVDSKLSKYSAIVFYEAHERTVSTDELYGLLEKNCRERPDMRLIVYPRRREVLHLLLRVPDPLHPSPYLPRRSPFTNDPESVYLDSALITVSPLGAWRRHPAIPRRPGRYRHRRRNPLLTHEGPRLMIPELIVLSVYSALPSEMQSQIFEPAPPGSRKVVIATNIAEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.38
4 0.42
5 0.44
6 0.52
7 0.53
8 0.52
9 0.52
10 0.5
11 0.47
12 0.44
13 0.4
14 0.38
15 0.38
16 0.36
17 0.36
18 0.38
19 0.35
20 0.36
21 0.36
22 0.34
23 0.33
24 0.36
25 0.39
26 0.35
27 0.35
28 0.28
29 0.23
30 0.22
31 0.21
32 0.18
33 0.18
34 0.18
35 0.2
36 0.29
37 0.38
38 0.4
39 0.46
40 0.48
41 0.53
42 0.61
43 0.65
44 0.66
45 0.63
46 0.63
47 0.63
48 0.6
49 0.52
50 0.43
51 0.4
52 0.34
53 0.28
54 0.22
55 0.17
56 0.17
57 0.24
58 0.24
59 0.2
60 0.16
61 0.15
62 0.16
63 0.18
64 0.17
65 0.1
66 0.11
67 0.1
68 0.1
69 0.11
70 0.1
71 0.08
72 0.08
73 0.1
74 0.1
75 0.16
76 0.19
77 0.2
78 0.23
79 0.25
80 0.29
81 0.37
82 0.39
83 0.35
84 0.37
85 0.39
86 0.45
87 0.48
88 0.46
89 0.37
90 0.37
91 0.35
92 0.32
93 0.34
94 0.34
95 0.33
96 0.32
97 0.31
98 0.3
99 0.3
100 0.28
101 0.23
102 0.16
103 0.15
104 0.15
105 0.17
106 0.15
107 0.17
108 0.22
109 0.29
110 0.33
111 0.3
112 0.31
113 0.33
114 0.36
115 0.39
116 0.39
117 0.38
118 0.38
119 0.37
120 0.38
121 0.35
122 0.34
123 0.3
124 0.25
125 0.18
126 0.12
127 0.11
128 0.08
129 0.07
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.05
136 0.07
137 0.09
138 0.11
139 0.15
140 0.19
141 0.22
142 0.29
143 0.37
144 0.45
145 0.53
146 0.59
147 0.64
148 0.68
149 0.74
150 0.78
151 0.8
152 0.82
153 0.83
154 0.86
155 0.89
156 0.89
157 0.91
158 0.87
159 0.85
160 0.83
161 0.77
162 0.71
163 0.64
164 0.57
165 0.47
166 0.4
167 0.32
168 0.24
169 0.19
170 0.14
171 0.12
172 0.11
173 0.1
174 0.1
175 0.08
176 0.07
177 0.07
178 0.07
179 0.05
180 0.05
181 0.06
182 0.06
183 0.08
184 0.11
185 0.12
186 0.13
187 0.14
188 0.15
189 0.18
190 0.18
191 0.17
192 0.16
193 0.17
194 0.22
195 0.23
196 0.25
197 0.25
198 0.27
199 0.28
200 0.29
201 0.32
202 0.29
203 0.31
204 0.29