Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WJ78

Protein Details
Accession A0A4P9WJ78   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-128LGLVKIDYRHKERKKTDKPKARKSYTWBasic
NLS Segment(s)
PositionSequence
111-124HKERKKTDKPKARK
Subcellular Location(s) mito 12, cyto 11.5, cyto_nucl 7, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000754  Ribosomal_S9  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00380  Ribosomal_S9  
Amino Acid Sequences IDEHGRSYHAASRKHGRAQVWMVPGEGHIYVNGMHFSDWFQEPHHLEIVVRPFEATGTLGKFNVWAIVDRGGPTGQSGALSVAIARAIATHDPSKDALLAELGLVKIDYRHKERKKTDKPKARKSYTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.52
4 0.53
5 0.54
6 0.55
7 0.49
8 0.43
9 0.36
10 0.31
11 0.3
12 0.24
13 0.18
14 0.12
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.08
21 0.07
22 0.07
23 0.08
24 0.1
25 0.11
26 0.11
27 0.12
28 0.17
29 0.18
30 0.2
31 0.2
32 0.17
33 0.15
34 0.18
35 0.22
36 0.17
37 0.16
38 0.14
39 0.13
40 0.12
41 0.13
42 0.1
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.09
51 0.07
52 0.06
53 0.07
54 0.08
55 0.09
56 0.09
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.05
75 0.06
76 0.09
77 0.11
78 0.11
79 0.13
80 0.14
81 0.15
82 0.14
83 0.13
84 0.11
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.06
93 0.08
94 0.15
95 0.21
96 0.27
97 0.38
98 0.46
99 0.57
100 0.67
101 0.75
102 0.81
103 0.86
104 0.9
105 0.9
106 0.93
107 0.94
108 0.95