Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WB94

Protein Details
Accession A0A4P9WB94   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-26VPERKVTCPPPQPARRAPKPANHydrophilic
73-103YMKSTEKNQKDIKRRPQLLRIKKTTKRTKIEHydrophilic
NLS Segment(s)
PositionSequence
85-95KRRPQLLRIKK
Subcellular Location(s) mito 13.5, cyto_mito 10.5, cyto 6.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MFIGVPERKVTCPPPQPARRAPKPANLVEGPPLLPWKITATDNVEKNNATNAKANYPWRDGSPGHALDLEGSYMKSTEKNQKDIKRRPQLLRIKKTTKRTKIEDEDDETRWQVSLNLTSIMLNHFNFTFGAIHTNGRAACFEELMILPGSRRHEVALPLGFLDKSRSQLPAMKTIPRSKARGALTLSLPARSLSATRASSLYCPTRTRPTYKKGKGSRGARSPMLTATSAWIVFLILRHIDADWHLRSCQYELEIGGQFKAKAKPPPGIGAPPEQNLVLVRRVHDAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.76
5 0.81
6 0.81
7 0.82
8 0.79
9 0.77
10 0.77
11 0.72
12 0.69
13 0.61
14 0.53
15 0.47
16 0.44
17 0.35
18 0.28
19 0.27
20 0.2
21 0.18
22 0.16
23 0.16
24 0.17
25 0.17
26 0.2
27 0.26
28 0.32
29 0.36
30 0.37
31 0.36
32 0.33
33 0.33
34 0.37
35 0.31
36 0.27
37 0.29
38 0.29
39 0.31
40 0.36
41 0.41
42 0.38
43 0.4
44 0.4
45 0.35
46 0.38
47 0.33
48 0.33
49 0.35
50 0.31
51 0.28
52 0.27
53 0.25
54 0.2
55 0.21
56 0.16
57 0.09
58 0.08
59 0.07
60 0.07
61 0.08
62 0.09
63 0.14
64 0.24
65 0.28
66 0.36
67 0.44
68 0.53
69 0.63
70 0.7
71 0.76
72 0.77
73 0.8
74 0.78
75 0.8
76 0.82
77 0.82
78 0.82
79 0.8
80 0.79
81 0.78
82 0.83
83 0.83
84 0.82
85 0.79
86 0.75
87 0.75
88 0.74
89 0.73
90 0.68
91 0.63
92 0.57
93 0.51
94 0.46
95 0.37
96 0.29
97 0.22
98 0.18
99 0.13
100 0.11
101 0.11
102 0.1
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.12
109 0.1
110 0.09
111 0.09
112 0.09
113 0.09
114 0.1
115 0.09
116 0.07
117 0.09
118 0.09
119 0.1
120 0.09
121 0.11
122 0.1
123 0.1
124 0.1
125 0.09
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.08
132 0.08
133 0.06
134 0.06
135 0.08
136 0.11
137 0.11
138 0.11
139 0.1
140 0.12
141 0.14
142 0.17
143 0.16
144 0.14
145 0.13
146 0.14
147 0.13
148 0.11
149 0.13
150 0.11
151 0.12
152 0.13
153 0.14
154 0.15
155 0.2
156 0.22
157 0.27
158 0.28
159 0.31
160 0.35
161 0.39
162 0.46
163 0.45
164 0.46
165 0.39
166 0.44
167 0.41
168 0.42
169 0.39
170 0.34
171 0.31
172 0.33
173 0.32
174 0.25
175 0.23
176 0.18
177 0.16
178 0.13
179 0.13
180 0.09
181 0.14
182 0.14
183 0.15
184 0.16
185 0.16
186 0.17
187 0.21
188 0.24
189 0.22
190 0.24
191 0.27
192 0.36
193 0.39
194 0.46
195 0.49
196 0.53
197 0.61
198 0.66
199 0.73
200 0.72
201 0.77
202 0.79
203 0.79
204 0.79
205 0.77
206 0.74
207 0.67
208 0.6
209 0.51
210 0.44
211 0.38
212 0.3
213 0.21
214 0.18
215 0.17
216 0.15
217 0.14
218 0.12
219 0.09
220 0.09
221 0.09
222 0.09
223 0.08
224 0.08
225 0.09
226 0.09
227 0.1
228 0.11
229 0.17
230 0.17
231 0.19
232 0.19
233 0.2
234 0.21
235 0.22
236 0.22
237 0.18
238 0.17
239 0.16
240 0.2
241 0.23
242 0.22
243 0.21
244 0.21
245 0.2
246 0.24
247 0.28
248 0.29
249 0.34
250 0.37
251 0.43
252 0.44
253 0.5
254 0.5
255 0.5
256 0.48
257 0.48
258 0.49
259 0.44
260 0.42
261 0.35
262 0.31
263 0.28
264 0.27
265 0.24
266 0.23
267 0.22