Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W5H9

Protein Details
Accession A0A4P9W5H9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
6-30TTPKLAQPSRKGKKAWRKNVDVGDVHydrophilic
NLS Segment(s)
PositionSequence
15-21RKGKKAW
138-157VKKRKAGDVVVGGGRKKAKK
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MTPATTTPKLAQPSRKGKKAWRKNVDVGDVEEKLDELRTEERLGGKVHEKKDAALFFTDTTGDEKNPPTKTSNRLPPPTSVKASLKHRKLRIDQILTPASTIPSIASRKTAASSVRLTTGPKLRNVSKAQLAAVERIVKKRKAGDVVVGGGRKKAKKVGGGMVDVWDVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.71
4 0.75
5 0.8
6 0.81
7 0.83
8 0.81
9 0.8
10 0.81
11 0.82
12 0.78
13 0.68
14 0.62
15 0.56
16 0.46
17 0.38
18 0.3
19 0.23
20 0.17
21 0.16
22 0.11
23 0.09
24 0.1
25 0.12
26 0.13
27 0.15
28 0.16
29 0.18
30 0.19
31 0.19
32 0.26
33 0.3
34 0.31
35 0.35
36 0.34
37 0.33
38 0.38
39 0.36
40 0.3
41 0.25
42 0.24
43 0.18
44 0.18
45 0.17
46 0.11
47 0.12
48 0.11
49 0.11
50 0.12
51 0.14
52 0.19
53 0.2
54 0.22
55 0.23
56 0.27
57 0.32
58 0.37
59 0.44
60 0.46
61 0.5
62 0.49
63 0.51
64 0.54
65 0.52
66 0.47
67 0.41
68 0.36
69 0.37
70 0.45
71 0.48
72 0.49
73 0.52
74 0.54
75 0.56
76 0.58
77 0.61
78 0.6
79 0.57
80 0.51
81 0.49
82 0.47
83 0.4
84 0.36
85 0.27
86 0.19
87 0.14
88 0.12
89 0.07
90 0.1
91 0.11
92 0.11
93 0.13
94 0.13
95 0.14
96 0.15
97 0.18
98 0.15
99 0.17
100 0.19
101 0.19
102 0.2
103 0.2
104 0.21
105 0.23
106 0.29
107 0.28
108 0.3
109 0.34
110 0.34
111 0.41
112 0.44
113 0.44
114 0.42
115 0.41
116 0.37
117 0.36
118 0.34
119 0.28
120 0.27
121 0.29
122 0.25
123 0.32
124 0.38
125 0.36
126 0.38
127 0.43
128 0.47
129 0.46
130 0.46
131 0.45
132 0.43
133 0.44
134 0.45
135 0.42
136 0.35
137 0.33
138 0.37
139 0.33
140 0.33
141 0.35
142 0.36
143 0.4
144 0.46
145 0.51
146 0.5
147 0.5
148 0.48
149 0.43