Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1IPJ4

Protein Details
Accession A0A4V1IPJ4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-46VTPTPPPRRHPFDRHRRPMIRBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007914  UPF0193  
Pfam View protein in Pfam  
PF05250  UPF0193  
Amino Acid Sequences MTFASRRTSNDTTATPTTATTTTPDVTPTPPPRRHPFDRHRRPMIRTLDRIIASDAYDVDGFRPMAKKDSRKEKEKLQNLMASNGASAVAAEDDDDGHGGAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.29
3 0.26
4 0.25
5 0.21
6 0.19
7 0.15
8 0.16
9 0.15
10 0.15
11 0.17
12 0.15
13 0.17
14 0.25
15 0.31
16 0.38
17 0.43
18 0.49
19 0.55
20 0.62
21 0.68
22 0.7
23 0.72
24 0.74
25 0.79
26 0.81
27 0.83
28 0.8
29 0.76
30 0.74
31 0.73
32 0.68
33 0.6
34 0.53
35 0.48
36 0.43
37 0.4
38 0.32
39 0.23
40 0.17
41 0.14
42 0.11
43 0.08
44 0.07
45 0.07
46 0.06
47 0.08
48 0.07
49 0.08
50 0.11
51 0.1
52 0.17
53 0.23
54 0.3
55 0.36
56 0.47
57 0.53
58 0.58
59 0.62
60 0.66
61 0.71
62 0.72
63 0.71
64 0.65
65 0.63
66 0.57
67 0.55
68 0.46
69 0.36
70 0.27
71 0.2
72 0.15
73 0.09
74 0.07
75 0.06
76 0.05
77 0.04
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06