Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WE23

Protein Details
Accession A0A4P9WE23   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-87EKCVIKVLKPVKKKKIKREIKILQNLSHydrophilic
NLS Segment(s)
PositionSequence
69-79KPVKKKKIKRE
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045216  CK2_alpha  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MSLSSVARVYANANVDQPRDYWDYDNLAINWGSQENYEIVRKIGRGKYSEVFEGINVANDEKCVIKVLKPVKKKKIKREIKILQNLSGGINVIQLLDVVRDPQVRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.22
5 0.22
6 0.22
7 0.23
8 0.22
9 0.22
10 0.24
11 0.25
12 0.28
13 0.23
14 0.22
15 0.2
16 0.18
17 0.16
18 0.12
19 0.11
20 0.08
21 0.09
22 0.08
23 0.1
24 0.11
25 0.11
26 0.11
27 0.12
28 0.13
29 0.18
30 0.2
31 0.22
32 0.22
33 0.26
34 0.28
35 0.29
36 0.29
37 0.23
38 0.2
39 0.16
40 0.16
41 0.12
42 0.1
43 0.08
44 0.08
45 0.07
46 0.07
47 0.08
48 0.06
49 0.06
50 0.08
51 0.08
52 0.09
53 0.16
54 0.25
55 0.32
56 0.41
57 0.5
58 0.59
59 0.69
60 0.76
61 0.81
62 0.83
63 0.86
64 0.85
65 0.87
66 0.86
67 0.85
68 0.87
69 0.78
70 0.71
71 0.62
72 0.54
73 0.43
74 0.34
75 0.25
76 0.14
77 0.12
78 0.09
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.1