Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9WHA4

Protein Details
Accession A0A4P9WHA4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-66LNAQKKEKKKHLNPKRVGADBasic
NLS Segment(s)
PositionSequence
51-60KKEKKKHLNP
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028015  CCDC84-like  
Pfam View protein in Pfam  
PF14968  CCDC84  
Amino Acid Sequences LASVNVPKLKPGEGNIHTPRAVPPWLADDPPRPTQAPIFGPSIDEFLNAQKKEKKKHLNPKRVGADFDRTNDSNPQWMPNFGRVWNAGPRSSTRKEWRQEDSEERDKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.45
4 0.42
5 0.4
6 0.38
7 0.32
8 0.3
9 0.22
10 0.18
11 0.2
12 0.22
13 0.22
14 0.23
15 0.25
16 0.29
17 0.32
18 0.34
19 0.29
20 0.28
21 0.28
22 0.31
23 0.28
24 0.25
25 0.23
26 0.21
27 0.21
28 0.2
29 0.2
30 0.15
31 0.12
32 0.1
33 0.12
34 0.19
35 0.18
36 0.21
37 0.24
38 0.3
39 0.36
40 0.45
41 0.51
42 0.54
43 0.65
44 0.73
45 0.78
46 0.79
47 0.81
48 0.79
49 0.7
50 0.63
51 0.55
52 0.51
53 0.43
54 0.4
55 0.35
56 0.29
57 0.29
58 0.29
59 0.27
60 0.25
61 0.23
62 0.25
63 0.21
64 0.24
65 0.25
66 0.27
67 0.28
68 0.24
69 0.27
70 0.24
71 0.26
72 0.3
73 0.31
74 0.27
75 0.27
76 0.31
77 0.36
78 0.39
79 0.45
80 0.47
81 0.53
82 0.6
83 0.65
84 0.68
85 0.66
86 0.69
87 0.69
88 0.68
89 0.68