Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9W3R1

Protein Details
Accession A0A4P9W3R1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-36PGYFGARKPRRFKSDRVREEESBasic
44-68GEDRKGPRPSFRQKRTRTSNTPPTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042855  V_SNARE_CC  
Pfam View protein in Pfam  
PF00957  Synaptobrevin  
PROSITE View protein in PROSITE  
PS50892  V_SNARE  
Amino Acid Sequences MTGSPRIMRVMSAVPGYFGARKPRRFKSDRVREEESLSAGAGCGEDRKGPRPSFRQKRTRTSNTPPTASTQEPLIAPPRPGRSSSCPPPSSSTRSSLPFHQPYPEAASDDDEPMESDEESQLTLTRGCASDGEDEEADDRAAFLWRSGGRTAYGTLYSDPTPEPGKTTTEAIKEQISAAHDAASRLVGKLLDRGANMKDMKAKAASLETAGSMFRRTGRNVESEKWWQAHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.21
4 0.21
5 0.21
6 0.29
7 0.35
8 0.44
9 0.52
10 0.6
11 0.68
12 0.7
13 0.77
14 0.77
15 0.8
16 0.81
17 0.81
18 0.79
19 0.7
20 0.69
21 0.61
22 0.52
23 0.41
24 0.31
25 0.23
26 0.15
27 0.13
28 0.09
29 0.07
30 0.07
31 0.07
32 0.11
33 0.14
34 0.2
35 0.27
36 0.3
37 0.38
38 0.47
39 0.57
40 0.64
41 0.71
42 0.76
43 0.77
44 0.84
45 0.86
46 0.86
47 0.84
48 0.82
49 0.83
50 0.78
51 0.73
52 0.63
53 0.58
54 0.53
55 0.45
56 0.36
57 0.26
58 0.22
59 0.19
60 0.2
61 0.19
62 0.16
63 0.16
64 0.2
65 0.24
66 0.24
67 0.26
68 0.29
69 0.33
70 0.4
71 0.47
72 0.51
73 0.47
74 0.47
75 0.51
76 0.51
77 0.49
78 0.44
79 0.39
80 0.34
81 0.37
82 0.37
83 0.36
84 0.4
85 0.37
86 0.35
87 0.33
88 0.3
89 0.28
90 0.31
91 0.27
92 0.19
93 0.16
94 0.18
95 0.16
96 0.15
97 0.14
98 0.09
99 0.08
100 0.08
101 0.08
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.07
113 0.07
114 0.07
115 0.08
116 0.09
117 0.11
118 0.11
119 0.13
120 0.11
121 0.11
122 0.12
123 0.11
124 0.1
125 0.07
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.09
132 0.1
133 0.13
134 0.13
135 0.14
136 0.13
137 0.15
138 0.16
139 0.13
140 0.13
141 0.12
142 0.12
143 0.14
144 0.13
145 0.13
146 0.12
147 0.13
148 0.15
149 0.14
150 0.16
151 0.15
152 0.17
153 0.18
154 0.21
155 0.22
156 0.24
157 0.25
158 0.24
159 0.24
160 0.21
161 0.2
162 0.19
163 0.17
164 0.16
165 0.14
166 0.15
167 0.15
168 0.14
169 0.15
170 0.14
171 0.13
172 0.11
173 0.12
174 0.1
175 0.1
176 0.13
177 0.16
178 0.16
179 0.17
180 0.19
181 0.19
182 0.25
183 0.25
184 0.24
185 0.28
186 0.27
187 0.29
188 0.28
189 0.27
190 0.22
191 0.24
192 0.23
193 0.17
194 0.17
195 0.15
196 0.14
197 0.14
198 0.13
199 0.12
200 0.12
201 0.15
202 0.19
203 0.21
204 0.28
205 0.31
206 0.38
207 0.42
208 0.45
209 0.48
210 0.51
211 0.54