Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9VZ36

Protein Details
Accession A0A4P9VZ36   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-92KNDSYRKGRLHWQRRKGKLSHRRSABasic
NLS Segment(s)
PositionSequence
74-92KGRLHWQRRKGKLSHRRSA
Subcellular Location(s) extr 17, mito 4, golg 3, plas 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MLAAAWQYGHRKPILMDSTLGVCLQKILLFVKLVIDESSRGVPVALFLFSVPLGNRQTSSGYDPEILKNDSYRKGRLHWQRRKGKLSHRRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.27
4 0.24
5 0.26
6 0.25
7 0.24
8 0.15
9 0.11
10 0.09
11 0.08
12 0.08
13 0.07
14 0.08
15 0.09
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.08
24 0.09
25 0.1
26 0.08
27 0.08
28 0.07
29 0.06
30 0.07
31 0.07
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.05
39 0.08
40 0.1
41 0.1
42 0.11
43 0.12
44 0.13
45 0.14
46 0.17
47 0.15
48 0.15
49 0.17
50 0.17
51 0.18
52 0.2
53 0.2
54 0.17
55 0.2
56 0.23
57 0.29
58 0.32
59 0.34
60 0.34
61 0.37
62 0.46
63 0.53
64 0.6
65 0.63
66 0.7
67 0.75
68 0.82
69 0.86
70 0.84
71 0.85
72 0.84