Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WA23

Protein Details
Accession A0A4P9WA23   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-38LAFVIWRHRRRIRRLPPNTPTSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 8, nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGQIAAALATLIALLAFVIWRHRRRIRRLPPNTPTSQLPRPLRDSPVSDMAPTAEILATTALGLARGASLPFACCTQAPSLLEHVRSPGDDCRFHSQQDSASHRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.03
5 0.03
6 0.11
7 0.18
8 0.22
9 0.3
10 0.39
11 0.48
12 0.57
13 0.68
14 0.72
15 0.77
16 0.83
17 0.85
18 0.84
19 0.83
20 0.76
21 0.68
22 0.61
23 0.56
24 0.52
25 0.5
26 0.47
27 0.43
28 0.46
29 0.45
30 0.45
31 0.41
32 0.39
33 0.34
34 0.36
35 0.32
36 0.26
37 0.23
38 0.2
39 0.17
40 0.14
41 0.11
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.05
59 0.06
60 0.07
61 0.08
62 0.07
63 0.1
64 0.11
65 0.15
66 0.15
67 0.17
68 0.22
69 0.24
70 0.26
71 0.24
72 0.24
73 0.21
74 0.21
75 0.22
76 0.23
77 0.26
78 0.27
79 0.32
80 0.39
81 0.4
82 0.4
83 0.41
84 0.37
85 0.37
86 0.44