Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WAN7

Protein Details
Accession A0A4P9WAN7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-73DEGAGRSTPKKKKNKKKSADSSVYYHydrophilic
NLS Segment(s)
PositionSequence
55-65STPKKKKNKKK
Subcellular Location(s) cyto_mito 9.666, mito 9.5, cyto 8.5, cyto_nucl 8.333, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MSLAVVGGFGGGGGGGGRAATNGKPFKFEYFVIFSKIYKEAASTADDEDEGAGRSTPKKKKNKKKSADSSVYYFQIEDEVIAEFAELFFDYKFSKEAQSTDSRRAFQEVGIDPLRRVFIVHRDKMEPMVAAMEARIVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.06
7 0.07
8 0.15
9 0.2
10 0.21
11 0.24
12 0.26
13 0.29
14 0.31
15 0.31
16 0.28
17 0.29
18 0.3
19 0.31
20 0.3
21 0.27
22 0.26
23 0.27
24 0.22
25 0.16
26 0.16
27 0.13
28 0.14
29 0.15
30 0.14
31 0.13
32 0.12
33 0.12
34 0.11
35 0.1
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.11
42 0.19
43 0.27
44 0.36
45 0.46
46 0.57
47 0.68
48 0.78
49 0.85
50 0.87
51 0.9
52 0.91
53 0.9
54 0.86
55 0.77
56 0.7
57 0.62
58 0.53
59 0.42
60 0.31
61 0.21
62 0.15
63 0.12
64 0.08
65 0.06
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.03
72 0.04
73 0.03
74 0.04
75 0.03
76 0.05
77 0.05
78 0.06
79 0.08
80 0.08
81 0.11
82 0.12
83 0.14
84 0.18
85 0.26
86 0.29
87 0.37
88 0.4
89 0.39
90 0.39
91 0.41
92 0.37
93 0.28
94 0.32
95 0.25
96 0.27
97 0.29
98 0.28
99 0.25
100 0.26
101 0.26
102 0.18
103 0.18
104 0.15
105 0.22
106 0.31
107 0.36
108 0.39
109 0.41
110 0.42
111 0.43
112 0.42
113 0.32
114 0.23
115 0.2
116 0.16
117 0.13
118 0.12