Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WPL4

Protein Details
Accession A0A4P9WPL4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-107GHAQWFKMKFKQKRDPNLSGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MKLIVPKELQVLLHKFSGLYRYWYNKCVWIQKTTGMRRKLDFAAVIKADHNRVCSPWVLDLPTALREGAPFELAKNIKAAQANSNNGHAQWFKMKFKQKRDPNLSGFALT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.22
4 0.24
5 0.19
6 0.2
7 0.23
8 0.3
9 0.33
10 0.36
11 0.36
12 0.39
13 0.42
14 0.45
15 0.43
16 0.39
17 0.38
18 0.42
19 0.5
20 0.52
21 0.55
22 0.52
23 0.51
24 0.49
25 0.51
26 0.46
27 0.39
28 0.32
29 0.26
30 0.25
31 0.23
32 0.22
33 0.19
34 0.19
35 0.19
36 0.17
37 0.18
38 0.14
39 0.14
40 0.15
41 0.14
42 0.14
43 0.13
44 0.13
45 0.12
46 0.11
47 0.11
48 0.1
49 0.11
50 0.1
51 0.09
52 0.08
53 0.07
54 0.08
55 0.08
56 0.09
57 0.08
58 0.07
59 0.14
60 0.14
61 0.15
62 0.15
63 0.15
64 0.17
65 0.19
66 0.2
67 0.22
68 0.28
69 0.33
70 0.33
71 0.36
72 0.33
73 0.31
74 0.33
75 0.26
76 0.22
77 0.25
78 0.29
79 0.31
80 0.39
81 0.5
82 0.55
83 0.65
84 0.73
85 0.74
86 0.8
87 0.84
88 0.84
89 0.79
90 0.79