Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NF62

Protein Details
Accession B8NF62    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-100YTMGWVKRLKIKKEEKEEKRLQDRQVHydrophilic
NLS Segment(s)
PositionSequence
86-87KK
Subcellular Location(s) nucl 23.5, mito_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MYAARNNFAFDTIYWKKIDQRFFGPTTHEDNDICDIWRKRLYLLKLEEKSIMEEYVNLKLKDRNTWRLVWDPDEYTMGWVKRLKIKKEEKEEKRLQDRQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.33
4 0.37
5 0.43
6 0.38
7 0.4
8 0.43
9 0.44
10 0.44
11 0.41
12 0.38
13 0.38
14 0.35
15 0.32
16 0.26
17 0.25
18 0.27
19 0.24
20 0.21
21 0.21
22 0.21
23 0.23
24 0.26
25 0.24
26 0.24
27 0.28
28 0.3
29 0.31
30 0.36
31 0.41
32 0.39
33 0.4
34 0.39
35 0.33
36 0.33
37 0.26
38 0.2
39 0.11
40 0.11
41 0.11
42 0.17
43 0.2
44 0.19
45 0.19
46 0.22
47 0.24
48 0.31
49 0.36
50 0.37
51 0.36
52 0.39
53 0.41
54 0.44
55 0.45
56 0.4
57 0.37
58 0.3
59 0.28
60 0.28
61 0.24
62 0.19
63 0.22
64 0.18
65 0.2
66 0.21
67 0.23
68 0.31
69 0.39
70 0.43
71 0.49
72 0.59
73 0.65
74 0.74
75 0.81
76 0.81
77 0.84
78 0.86
79 0.86
80 0.86