Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WQW1

Protein Details
Accession A0A4P9WQW1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-26FINHILRKGKKDRARKIMQDALHydrophilic
NLS Segment(s)
PositionSequence
12-19KGKKDRAR
Subcellular Location(s) mito 10.5, nucl 9, cyto_mito 8.666, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000235  Ribosomal_S5/S7  
IPR023798  Ribosomal_S7_dom  
IPR036823  Ribosomal_S7_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00177  Ribosomal_S7  
Amino Acid Sequences VSEAFINHILRKGKKDRARKIMQDALDHINGLVPGISPLEALAIAVDKAAPLVKTSGSKRGAKTILTPTPLTQRQRFRLGCVWIIESANPGYGKERAGTLGQRIGQEVVNVINGQSNILQRKAQVHKTALANRSNIAMTDRRIIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.73
4 0.77
5 0.82
6 0.81
7 0.82
8 0.79
9 0.73
10 0.66
11 0.59
12 0.53
13 0.44
14 0.37
15 0.28
16 0.21
17 0.18
18 0.14
19 0.1
20 0.06
21 0.05
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.04
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.12
42 0.14
43 0.22
44 0.26
45 0.3
46 0.3
47 0.36
48 0.36
49 0.32
50 0.35
51 0.34
52 0.33
53 0.31
54 0.31
55 0.26
56 0.31
57 0.35
58 0.35
59 0.34
60 0.37
61 0.38
62 0.47
63 0.46
64 0.43
65 0.43
66 0.42
67 0.38
68 0.33
69 0.3
70 0.23
71 0.22
72 0.18
73 0.14
74 0.12
75 0.11
76 0.1
77 0.09
78 0.1
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.13
85 0.14
86 0.14
87 0.17
88 0.19
89 0.19
90 0.19
91 0.19
92 0.17
93 0.16
94 0.14
95 0.1
96 0.09
97 0.09
98 0.08
99 0.09
100 0.09
101 0.09
102 0.11
103 0.15
104 0.17
105 0.19
106 0.2
107 0.19
108 0.28
109 0.35
110 0.4
111 0.42
112 0.42
113 0.46
114 0.53
115 0.59
116 0.57
117 0.54
118 0.49
119 0.43
120 0.42
121 0.36
122 0.29
123 0.26
124 0.24
125 0.22
126 0.3