Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WCC3

Protein Details
Accession A0A4P9WCC3   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
153-175KEAKEELKRKARQLDNQKREMAKBasic
NLS Segment(s)
PositionSequence
161-162RK
Subcellular Location(s) mito 15, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022775  AP_mu_sigma_su  
IPR027059  Coatomer_dsu  
IPR011012  Longin-like_dom_sf  
Gene Ontology GO:0030126  C:COPI vesicle coat  
GO:0000139  C:Golgi membrane  
GO:0015031  P:protein transport  
GO:0006890  P:retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum  
Pfam View protein in Pfam  
PF01217  Clat_adaptor_s  
CDD cd14830  Delta_COP_N  
Amino Acid Sequences QVVLAAAICTKTGKAVVSRQFVEMARSRIEGLLASFPKLIGASDQHTFVETDSVRYVYQPLEELFMVLITNKNSNILQDIDTLHLFARVTSEHCRSLEEREISRHAFELLMIFEEIVAIGYRESVTLPQIRTICEMESHEERVQAEIALNKEKEAKEELKRKARQLDNQKREMAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.32
4 0.38
5 0.39
6 0.39
7 0.41
8 0.39
9 0.4
10 0.36
11 0.32
12 0.28
13 0.27
14 0.27
15 0.23
16 0.23
17 0.18
18 0.15
19 0.19
20 0.18
21 0.18
22 0.17
23 0.17
24 0.17
25 0.16
26 0.14
27 0.09
28 0.11
29 0.12
30 0.13
31 0.14
32 0.14
33 0.15
34 0.15
35 0.13
36 0.16
37 0.13
38 0.14
39 0.14
40 0.15
41 0.14
42 0.14
43 0.15
44 0.1
45 0.11
46 0.11
47 0.1
48 0.11
49 0.11
50 0.1
51 0.09
52 0.08
53 0.08
54 0.06
55 0.08
56 0.06
57 0.08
58 0.07
59 0.09
60 0.09
61 0.09
62 0.11
63 0.11
64 0.11
65 0.11
66 0.12
67 0.12
68 0.11
69 0.12
70 0.09
71 0.09
72 0.08
73 0.07
74 0.07
75 0.06
76 0.09
77 0.12
78 0.15
79 0.16
80 0.16
81 0.19
82 0.19
83 0.22
84 0.27
85 0.26
86 0.25
87 0.26
88 0.29
89 0.28
90 0.27
91 0.23
92 0.17
93 0.13
94 0.12
95 0.1
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.08
113 0.12
114 0.13
115 0.18
116 0.19
117 0.2
118 0.22
119 0.23
120 0.21
121 0.19
122 0.2
123 0.21
124 0.23
125 0.27
126 0.25
127 0.25
128 0.25
129 0.24
130 0.23
131 0.18
132 0.17
133 0.15
134 0.17
135 0.22
136 0.21
137 0.21
138 0.26
139 0.26
140 0.27
141 0.3
142 0.34
143 0.38
144 0.47
145 0.56
146 0.6
147 0.66
148 0.7
149 0.74
150 0.76
151 0.76
152 0.78
153 0.8
154 0.79
155 0.8