Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NRZ2

Protein Details
Accession B8NRZ2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-111GTLPQPTYPKKPKRRPGQLPPPPFGHydrophilic
NLS Segment(s)
PositionSequence
96-104KKPKRRPGQ
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013085  U1-CZ_Znf_C2H2  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF06220  zf-U1  
Amino Acid Sequences MSVRKAHNAGRNHLRNVLEYYQRTFQLRRLPRLTQSNAHQPHTEIGQEKAQSVIDSITSSYAAEGQAVPNPAMAPPGAFPPPFPFPGTLPQPTYPKKPKRRPGQLPPPPFGFPPPGGPNGAPGMPPPPGAKGLPFPPPFPQASGAPGSLPPLPNMPAGNVPFPPPPGGFPPNFQIPAPGAPGFPPMPGAIPGQPGFSPSSTPGISGPPGQEGGYAPPPGAGSAGLPGPPPGLGEPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.52
4 0.49
5 0.46
6 0.41
7 0.43
8 0.41
9 0.43
10 0.44
11 0.39
12 0.38
13 0.41
14 0.47
15 0.51
16 0.52
17 0.54
18 0.58
19 0.65
20 0.65
21 0.61
22 0.59
23 0.61
24 0.6
25 0.59
26 0.52
27 0.44
28 0.41
29 0.36
30 0.34
31 0.25
32 0.23
33 0.24
34 0.24
35 0.23
36 0.22
37 0.2
38 0.17
39 0.16
40 0.13
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.07
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.1
54 0.11
55 0.11
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.07
62 0.06
63 0.09
64 0.11
65 0.1
66 0.11
67 0.14
68 0.18
69 0.19
70 0.19
71 0.18
72 0.17
73 0.24
74 0.28
75 0.26
76 0.26
77 0.28
78 0.34
79 0.35
80 0.42
81 0.46
82 0.52
83 0.6
84 0.67
85 0.74
86 0.78
87 0.86
88 0.87
89 0.87
90 0.89
91 0.87
92 0.83
93 0.76
94 0.68
95 0.59
96 0.49
97 0.4
98 0.31
99 0.23
100 0.22
101 0.21
102 0.19
103 0.19
104 0.19
105 0.18
106 0.16
107 0.16
108 0.11
109 0.09
110 0.1
111 0.09
112 0.1
113 0.09
114 0.09
115 0.11
116 0.11
117 0.12
118 0.12
119 0.15
120 0.22
121 0.23
122 0.23
123 0.24
124 0.27
125 0.26
126 0.25
127 0.25
128 0.17
129 0.19
130 0.2
131 0.17
132 0.14
133 0.14
134 0.14
135 0.13
136 0.13
137 0.11
138 0.11
139 0.12
140 0.13
141 0.13
142 0.13
143 0.15
144 0.16
145 0.17
146 0.16
147 0.17
148 0.17
149 0.18
150 0.19
151 0.15
152 0.16
153 0.2
154 0.24
155 0.22
156 0.23
157 0.27
158 0.29
159 0.3
160 0.27
161 0.24
162 0.21
163 0.22
164 0.23
165 0.2
166 0.15
167 0.14
168 0.18
169 0.16
170 0.15
171 0.14
172 0.11
173 0.12
174 0.13
175 0.15
176 0.12
177 0.16
178 0.17
179 0.17
180 0.17
181 0.17
182 0.18
183 0.17
184 0.17
185 0.15
186 0.2
187 0.18
188 0.19
189 0.18
190 0.19
191 0.2
192 0.2
193 0.19
194 0.17
195 0.18
196 0.17
197 0.17
198 0.15
199 0.19
200 0.22
201 0.21
202 0.18
203 0.18
204 0.19
205 0.18
206 0.17
207 0.12
208 0.07
209 0.09
210 0.11
211 0.1
212 0.1
213 0.11
214 0.11
215 0.11
216 0.12