Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WGB5

Protein Details
Accession A0A4P9WGB5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-42AAQDTYKTRQKKKAWLNERKSKAKAKKRKRDDSEDETLRHydrophilic
NLS Segment(s)
PositionSequence
12-33RQKKKAWLNERKSKAKAKKRKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
Amino Acid Sequences MHVAAQDTYKTRQKKKAWLNERKSKAKAKKRKRDDSEDETLRDDIKFGTVVQAPPTLTAVPKNRGGKAVTDNPTDAEETRKKEGEPHTVEAWRKKKFKTLAEAEKKSLTAERERVIAFYRAIKSNQASAKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.75
3 0.8
4 0.83
5 0.85
6 0.87
7 0.88
8 0.9
9 0.87
10 0.83
11 0.82
12 0.82
13 0.82
14 0.82
15 0.83
16 0.85
17 0.88
18 0.92
19 0.9
20 0.9
21 0.88
22 0.85
23 0.83
24 0.76
25 0.67
26 0.58
27 0.5
28 0.4
29 0.31
30 0.24
31 0.14
32 0.11
33 0.09
34 0.07
35 0.1
36 0.11
37 0.12
38 0.13
39 0.14
40 0.13
41 0.13
42 0.14
43 0.11
44 0.1
45 0.14
46 0.17
47 0.18
48 0.24
49 0.26
50 0.26
51 0.28
52 0.29
53 0.26
54 0.27
55 0.32
56 0.29
57 0.28
58 0.27
59 0.26
60 0.26
61 0.24
62 0.19
63 0.17
64 0.18
65 0.21
66 0.24
67 0.24
68 0.23
69 0.29
70 0.34
71 0.37
72 0.38
73 0.38
74 0.38
75 0.42
76 0.46
77 0.48
78 0.51
79 0.49
80 0.49
81 0.47
82 0.52
83 0.55
84 0.58
85 0.59
86 0.61
87 0.64
88 0.7
89 0.72
90 0.67
91 0.61
92 0.55
93 0.46
94 0.4
95 0.33
96 0.3
97 0.31
98 0.3
99 0.32
100 0.32
101 0.32
102 0.31
103 0.3
104 0.25
105 0.27
106 0.29
107 0.3
108 0.31
109 0.35
110 0.34
111 0.39
112 0.42