Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9WDE1

Protein Details
Accession A0A4P9WDE1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
302-331KLVPDPPSDPRRRRRSHQTRAPQHRRWLVDBasic
358-378VGTPQRARRRHRPIVVDVRDPHydrophilic
NLS Segment(s)
PositionSequence
312-316RRRRR
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEYLPKAAAQTTRFDATVANITNIGFFNNCDVCTAGRGQGEESNLARAAWTDTSRVARDRSPNSGVSDVILDFFSMTGTTGSGIVVVIQLLLVSYMWARIGRGSYWNMLLAMSLVAFVGISMQNFEAIMYNKTGDTRWWIMSPLTEPCWIFVEFGIVILNLIKLRVLVPRMHFKIVLALETLLFLAFSVLRLRIGLRRLSDHVDYSVAIWNLHTPAFAVTAAAEAIPSIMLIRFVWKEVRADSGGLRVGTHKHLFKSSFFVLLLVDLSAIMLAIVSAFPSDRSQEVLSLFLNIKGCFALIAKLVPDPPSDPRRRRRSHQTRAPQHRRWLVDAQAPATHILPALPAPRNDYQHPPPMAVGTPQRARRRHRPIVVDVRDPGAGPDFFLWPQPVQEREHREEGRGACTAQSICGPAPGARG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.24
4 0.3
5 0.26
6 0.22
7 0.21
8 0.21
9 0.22
10 0.21
11 0.19
12 0.12
13 0.11
14 0.16
15 0.17
16 0.17
17 0.16
18 0.17
19 0.17
20 0.19
21 0.21
22 0.19
23 0.19
24 0.2
25 0.21
26 0.23
27 0.24
28 0.25
29 0.24
30 0.23
31 0.21
32 0.2
33 0.18
34 0.16
35 0.17
36 0.17
37 0.17
38 0.16
39 0.19
40 0.24
41 0.27
42 0.3
43 0.29
44 0.32
45 0.39
46 0.42
47 0.45
48 0.45
49 0.45
50 0.46
51 0.44
52 0.38
53 0.3
54 0.27
55 0.2
56 0.17
57 0.14
58 0.1
59 0.08
60 0.08
61 0.07
62 0.05
63 0.06
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.06
85 0.06
86 0.08
87 0.1
88 0.11
89 0.15
90 0.17
91 0.18
92 0.19
93 0.19
94 0.18
95 0.16
96 0.14
97 0.1
98 0.08
99 0.06
100 0.05
101 0.04
102 0.03
103 0.03
104 0.03
105 0.04
106 0.05
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.08
114 0.09
115 0.1
116 0.1
117 0.11
118 0.11
119 0.12
120 0.12
121 0.11
122 0.15
123 0.17
124 0.18
125 0.18
126 0.19
127 0.18
128 0.2
129 0.21
130 0.18
131 0.17
132 0.18
133 0.17
134 0.17
135 0.19
136 0.18
137 0.16
138 0.13
139 0.13
140 0.11
141 0.11
142 0.1
143 0.07
144 0.07
145 0.06
146 0.07
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.08
153 0.1
154 0.13
155 0.16
156 0.25
157 0.28
158 0.29
159 0.28
160 0.25
161 0.29
162 0.26
163 0.23
164 0.15
165 0.12
166 0.11
167 0.11
168 0.11
169 0.05
170 0.04
171 0.04
172 0.03
173 0.03
174 0.04
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.1
181 0.12
182 0.15
183 0.15
184 0.17
185 0.19
186 0.22
187 0.22
188 0.2
189 0.18
190 0.16
191 0.15
192 0.13
193 0.14
194 0.11
195 0.1
196 0.09
197 0.09
198 0.1
199 0.09
200 0.08
201 0.05
202 0.05
203 0.06
204 0.06
205 0.06
206 0.05
207 0.05
208 0.05
209 0.04
210 0.04
211 0.03
212 0.03
213 0.03
214 0.02
215 0.03
216 0.03
217 0.03
218 0.03
219 0.06
220 0.06
221 0.08
222 0.1
223 0.1
224 0.12
225 0.12
226 0.15
227 0.14
228 0.14
229 0.14
230 0.14
231 0.15
232 0.14
233 0.13
234 0.11
235 0.13
236 0.16
237 0.19
238 0.19
239 0.19
240 0.23
241 0.25
242 0.25
243 0.29
244 0.25
245 0.24
246 0.21
247 0.2
248 0.16
249 0.15
250 0.14
251 0.08
252 0.06
253 0.04
254 0.04
255 0.03
256 0.03
257 0.02
258 0.02
259 0.02
260 0.02
261 0.02
262 0.02
263 0.02
264 0.03
265 0.04
266 0.05
267 0.07
268 0.07
269 0.1
270 0.11
271 0.13
272 0.13
273 0.14
274 0.13
275 0.14
276 0.15
277 0.14
278 0.16
279 0.14
280 0.14
281 0.12
282 0.12
283 0.1
284 0.1
285 0.09
286 0.08
287 0.08
288 0.08
289 0.1
290 0.11
291 0.12
292 0.12
293 0.13
294 0.19
295 0.29
296 0.38
297 0.45
298 0.54
299 0.64
300 0.7
301 0.76
302 0.81
303 0.82
304 0.84
305 0.86
306 0.87
307 0.87
308 0.92
309 0.94
310 0.9
311 0.87
312 0.84
313 0.76
314 0.7
315 0.65
316 0.58
317 0.54
318 0.49
319 0.42
320 0.36
321 0.33
322 0.28
323 0.23
324 0.19
325 0.13
326 0.1
327 0.09
328 0.1
329 0.15
330 0.17
331 0.18
332 0.23
333 0.28
334 0.33
335 0.36
336 0.41
337 0.41
338 0.47
339 0.48
340 0.44
341 0.39
342 0.37
343 0.35
344 0.31
345 0.31
346 0.29
347 0.35
348 0.42
349 0.5
350 0.56
351 0.63
352 0.7
353 0.74
354 0.77
355 0.79
356 0.78
357 0.79
358 0.83
359 0.8
360 0.75
361 0.66
362 0.58
363 0.5
364 0.42
365 0.33
366 0.27
367 0.21
368 0.16
369 0.16
370 0.16
371 0.16
372 0.19
373 0.21
374 0.16
375 0.21
376 0.25
377 0.27
378 0.3
379 0.38
380 0.44
381 0.48
382 0.57
383 0.54
384 0.52
385 0.56
386 0.54
387 0.5
388 0.43
389 0.37
390 0.28
391 0.31
392 0.28
393 0.22
394 0.22
395 0.2
396 0.18
397 0.2
398 0.21